DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and auh

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001003576.2 Gene:auh / 445182 ZFINID:ZDB-GENE-040801-95 Length:325 Species:Danio rerio


Alignment Length:242 Identity:72/242 - (29%)
Similarity:110/242 - (45%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RFTAASRTFSSTKALHKDPATQEAEAAPPKNILVE----KDKNITLIGINRPQQRNAIDSLTASQ 78
            |.....|.||....|:      .:|.....:::|.    .|..|.::|||||:.:|||.....|.
Zfish    38 RLPCVHRAFSGGVRLY------SSEVNSGDDLIVRYLDGDDSGIVVMGINRPEAKNAISKNLVSM 96

  Fly    79 LCDAFANFEADDTSPVAVLYG-VGGSFCSGFDILEISTDEKEEISVDILMRPEGSVGP--TRRQ- 139
            :.:|..:.:.|:|....:|.. |.|.||:|.|:.|.:..::.|            |||  |:.: 
Zfish    97 MSEALESMKTDNTVRTVILCSMVPGIFCAGADLKERAKMQQSE------------VGPFVTKART 149

  Fly   140 -------IKKPVVCGINGYCIANGLELALMCDLRVMEESAVLGFFNRRFGVPMLDAGTIRLPAMI 197
                   :..|.:..|:|..:..|||:||.||:||...||.:|....:..:.....||.|||..:
Zfish   150 LISELGALPMPTIAAIDGAALGGGLEMALACDIRVAANSAKMGLVETKLAIIPGAGGTQRLPRTV 214

  Fly   198 GLSRALDLILTGRPVGSQEAHDIGLVNRIVPTG----TALGNALELA 240
            |:|.|.:||...|.:..:||..:||||..|...    .|...||:||
Zfish   215 GVSIAKELIFAARVLNGEEAKSLGLVNHAVEQNKGGDAAYLRALDLA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 66/211 (31%)
auhNP_001003576.2 crotonase-like 71..325 CDD:304874 65/203 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.