DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and CG5044

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster


Alignment Length:368 Identity:77/368 - (20%)
Similarity:135/368 - (36%) Gaps:57/368 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TFSSTKALHKDPATQEAEA-APPKNILVEKDKNITLIGINRPQQRNAIDSLTASQLCDAFANFEA 88
            |.|.||     |.|..... ....::|..:..|..:|.:|||:..|||:.....::.....  :.
  Fly    27 TISQTK-----PTTMALSVRQSSSSVLATESSNKGMIILNRPKALNAINLEMVRKIYKHLK--KC 84

  Fly    89 DDTSPVAVLYGVGG-SFCSGFDILEI----STDEKEEISVDILMRPEGSVGPTRRQIKKPVVCGI 148
            :.:..:.::.|.|. :||:|.|:..:    .|||.:.     ..|.|.|........|.|.:..|
  Fly    85 EKSKSLVIIKGTGDKAFCAGGDVRALVEAGPTDESKS-----FFREEYSTNALIGNYKIPYIAII 144

  Fly   149 NGYCIANGLELALMCDLRVMEESAVLGFFNRRFGVPMLDAGTIRLPAMIGLSRALDLILTGRPVG 213
            :|..:..|:.|::....||..:..:........|:.....|:..||.:.| ...|.|.|||..:.
  Fly   145 DGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQG-KLGLYLGLTGYRLR 208

  Fly   214 SQEAHDIGLVNRI-----VPTGTALGNALELATCLAKFPQRALIHDRNSVYSSTFETSTFHQAVQ 273
            ..:.:..|:....     :|         :|.|.|...|....:.:....|.|..|.....|.|.
  Fly   209 GADVYYSGIATHYCESSKIP---------DLETALLNCPDADDVPELLQKYHSPPEKPFSLQPVL 264

  Fly   274 NEV--MFTS---REIIEDMQN-GIKWFNQTFKPDTTHSWLKRDRSMADWDDEEVAEAAAQKEKLK 332
            .::  .|::   ..|:|::|| |.:|..:|.:   |.|.:........:...|:....:..:.|.
  Fly   265 EQINKNFSADSVEGILENLQNDGSEWAKKTLE---TLSKMSPTSMKVTFRQLELGSQLSLAQCLI 326

  Fly   333 QEQEAALAEAEK---------------QKQAEKAQKRSKKTEE 360
            .|...|:...|:               ||...:..|.:..|||
  Fly   327 MEYRLAVRHLERSDFKEGVRALLIDKDQKPQWQPTKLADVTEE 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 45/219 (21%)
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 71/346 (21%)
ECH_2 56..374 CDD:292731 69/334 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451201
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.