DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and HIPP1

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster


Alignment Length:381 Identity:74/381 - (19%)
Similarity:120/381 - (31%) Gaps:125/381 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AASRTFSSTKALHKDPATQEAEAAPPKNILVEKDKNITLIGINRPQQRNAIDSLTAS----QLCD 81
            :|..|..||          :||..||.   |||.:.:.|       :..|:::|:.|    .|.:
  Fly     7 SAVTTLEST----------QAEEPPPG---VEKVETLEL-------KTAALETLSESAGPTDLEN 51

  Fly    82 AFANFEADDTSPVAVLYGVGGSFCSGFDILEISTDEKEEISVDILMRPEGSVGPTRRQIK---KP 143
            ..||....:..|             |.|  |:||.|:|...:..:..|:.:     .::|   .|
  Fly    52 ELANLNGSEEGP-------------GLD--ELSTLEREIAKLHNIRPPDAA-----SEVKDSDTP 96

  Fly   144 VVCGINGYCIANGLEL-----ALMCDLRVMEESAVLGFFNRRFGVPMLDAGTIRLPAMIGLSRAL 203
            :....||     |||.     ...|...::||........:....|:               ..:
  Fly    97 IALADNG-----GLEPRQAPDEAKCRTPIIEEGNAASGNGQSSESPL---------------EEV 141

  Fly   204 DLILTGRPVGSQEAHDIGLVNRIVPTGTALGNALELATCLAKFPQRALIHDRNSVYSSTFETSTF 268
            |||...:  |:..:||       .|||                .::..:....|......|....
  Fly   142 DLIALLK--GTDTSHD-------QPTG----------------EEKCTLEKALSELDGVGEDGDV 181

  Fly   269 HQAVQNEVMFTSREIIEDMQNGIKWFNQTFKPDTTHSWLKRDRSMADWDDEEVAEAAAQKEKLKQ 333
            ...::.|..|...||.:|....   .::...|....|...:..|:          .:..|.||..
  Fly   182 GVTIEGEGQFEIMEIDDDEGES---SSRKASPKVPASKPIKSNSL----------PSISKHKLSP 233

  Fly   334 EQEAALAEAEKQKQAEKAQKRSKKTEESAAESV-----------DSKDPKDKPNEK 378
            ||..|:|    .:|....:.:|::.|..|..||           |..|..|...:|
  Fly   234 EQARAVA----LEQMAGLKPKSRRKEPPAPPSVVAPIDIVSSLNDDWDDYDSEEDK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 40/221 (18%)
HIPP1NP_649261.1 crotonase-like 673..870 CDD:119339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451181
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.