DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and Dci

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster


Alignment Length:276 Identity:60/276 - (21%)
Similarity:110/276 - (39%) Gaps:65/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KNILVEKDKNITLIGINRPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVGGSFCSGFDIL 111
            |.:|||:...:.:...|.|:::|.|:.:...::.........|:...:.|..|||..|.||.|:.
  Fly     7 KELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGNDLS 71

  Fly   112 EIS-TDEKEEISVDILMRPEGSVGPTRRQI-------KKPVVCGINGYCIANGLELALMCDLRVM 168
            :.| ||:     :|...:...:   |.:.:       :|.|:..:||..|..|..:..:||:...
  Fly    72 QSSNTDD-----IDAFFKQSNA---TFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWC 128

  Fly   169 EESAVLGFFNRRFGVPMLDAGTI-------RLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRI 226
            .|:..       |..|....|.:       .||.::|.|:|.:::|...|:.:|||:....|:||
  Fly   129 SETTY-------FYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRI 186

  Fly   227 VPTGTALGNALELATCL-------AKFPQRALIHDRNSVYS------------------STFETS 266
            .       .|.||.:.:       ::.|..:|:..:..|..                  ..|:..
  Fly   187 F-------KASELESVIWPKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQHP 244

  Fly   267 TFHQAVQNEVMFTSRE 282
            .|.||:   :.|.||:
  Fly   245 EFAQAI---IDFASRK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 51/231 (22%)
DciNP_612065.1 crotonase-like 9..197 CDD:119339 49/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451177
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.