DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and CG6984

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_611187.1 Gene:CG6984 / 36926 FlyBaseID:FBgn0034191 Length:285 Species:Drosophila melanogaster


Alignment Length:275 Identity:64/275 - (23%)
Similarity:112/275 - (40%) Gaps:35/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PPKNILVEKDKNITLIGINRPQQRNAIDSLTASQLC---DAFANFEADDTSPVAVLYGVGGSFCS 106
            |...:||::...:..|.:|.|:   .::||:...:|   ||....:.:......||...|..:.:
  Fly    30 PSDLVLVKEHNGVREITLNHPK---TLNSLSLDMMCALQDALLKDKDNLDLRCVVLTAQGKIWSA 91

  Fly   107 GFDILEISTDEKEEISVDILMRPEGSVGPTRRQIKKPVVCGINGYCIANGLELALMCDLRVMEES 171
            |.::.|:..|.|  |...:..:....:...:| :..||:..:|||..|.|.:|.:.||:.|..: 
  Fly    92 GHNLKELHNDPK--IQACVFQKLTDVINDIQR-LPVPVLGKVNGYAAAAGCQLVVSCDMVVCTK- 152

  Fly   172 AVLGFFNRRFGVPMLDAGTIRLPAMIGLSRALD------LILTGRPVGSQEAHDIGLVNRIVPTG 230
                  |.:|..|....|.......:.::|.:.      :::||.||..:||:..|:|.:.|| .
  Fly   153 ------NSKFSTPGAGVGVFCSTPGVAVARIMSRPKSAYMLMTGLPVTGEEAYISGMVTKAVP-A 210

  Fly   231 TALGNALELATCLAKFPQRALIHDRNSVYSSTFETSTFHQAVQNEVMFTSRE------IIEDMQN 289
            ..|...:|..|...|...||:|......|......|      |.|....::|      .:.|.:.
  Fly   211 EELDKEIEEITNAIKAKSRAVISLGKEFYYKQLAMS------QAEAFSAAQEKMCENFQLGDTKE 269

  Fly   290 GIKWFNQTFKPDTTH 304
            ||..|.:...|:..|
  Fly   270 GIASFFEKRPPNWKH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 52/218 (24%)
CG6984NP_611187.1 crotonase-like 24..283 CDD:304874 63/272 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.