DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and Echs1

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster


Alignment Length:276 Identity:81/276 - (29%)
Similarity:132/276 - (47%) Gaps:43/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ASRTFSSTKALHKDP--ATQEAEAAPPKN---ILVE---KDKNITLIGINRPQQRNAIDSLTASQ 78
            |||.....:|..:.|  ||:.:.::...|   |..|   :.||:.:|.:|||:..||:.:....:
  Fly     9 ASRAQCVLQAAARQPQVATRFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKE 73

  Fly    79 LCDAFANFEADDTSPVAVLYGVGGSFCSGFDILEISTDEKEEISVDILMRPEGSVGPTRRQIKKP 143
            |..|...|..|.|....||.|...:|.:|.||.|:..:...:......:.....|..|    :||
  Fly    74 LSTALQQFSKDKTISAIVLTGSEKAFAAGADIKEMVGNTYSQCIQGNFLNDWTEVART----QKP 134

  Fly   144 VVCGINGYCIANGLELALMCDLRVMEESAVLGFFNRRFGVPMLDAGTI-------RLPAMIGLSR 201
            ::..:|||.:..|.|||:|||:....:.|       :||.|.:..|||       ||..::|.|:
  Fly   135 IIAAVNGYALGGGCELAMMCDIIYAGDKA-------KFGQPEIALGTIPGAGGTQRLTRVVGKSK 192

  Fly   202 ALDLILTGRPVGSQEAHDIGLVNRIVPTGTALGNALEL-------ATCLAKFPQRALIHDRNSVY 259
            |:::.|||..:|:|||..:||.:::||....||.|::|       :..:.:..:.|:    |:.|
  Fly   193 AMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEAVKLGEKIGTHSNLIVQLCKEAV----NTAY 253

  Fly   260 SST------FETSTFH 269
            .:|      ||..|||
  Fly   254 ETTLQEGLKFERRTFH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 66/226 (29%)
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451192
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104104at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.