DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and CG8778

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster


Alignment Length:258 Identity:78/258 - (30%)
Similarity:117/258 - (45%) Gaps:43/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRKFGGLLAQQVGQQARFTAASRTFSSTKALHKDPATQEAEAAP---PKNILVEK----DKNIT 58
            ||.|....||:|:   ||...|||..:|              |||   ...:|||:    .:.|:
  Fly     3 MLIKRASGLARQL---ARPLVASRNLAS--------------AAPYGDGTEVLVERLDGARQGIS 50

  Fly    59 LIGINRPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVG-GSFCSGFDILE---ISTDEKE 119
            :||:|||..:|:..........|...:.:.|:.|.|.||..:. |.||:|.|:.|   ::.:|..
  Fly    51 VIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGMTPEEAT 115

  Fly   120 EISVD---ILMRPEGSVGPTRRQIKKPVVCGINGYCIANGLELALMCDLRVMEESAVLGFFNRRF 181
            |...:   :|:..|        |:..||:..::|..:..|||:||.||:|.......:|....|.
  Fly   116 EFVKELRGLLIAIE--------QLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRL 172

  Fly   182 GVPMLDAGTIRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPTG----TALGNALELA 240
            .:.....||.|||.::..:.|.:||.|.|.....||.|:||||.:|...    .|...||:||
  Fly   173 AIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 63/207 (30%)
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 60/196 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451199
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.