DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and Auh

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006253736.1 Gene:Auh / 361215 RGDID:1306087 Length:315 Species:Rattus norvegicus


Alignment Length:239 Identity:67/239 - (28%)
Similarity:105/239 - (43%) Gaps:36/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ARFTAASRTFSSTKALHKDPATQEAEAAPPKNILVEKDKNITLIGINRPQQRNAIDSLTASQLCD 81
            ||.||..|.:||......:...:..|         |:::.|.::||||...:|::.......|..
  Rat    34 ARGTAPRRGYSSEVKTEDELRVRHLE---------EENRGIVVLGINRAYGKNSLSKNLLKMLSK 89

  Fly    82 AFANFEAD-DTSPVAVLYGVGGSFCSGFDILEISTDEKEEISVDILMRPEGSVGPTRRQIKK--- 142
            |....::| ....:.:...|.|.||:|.|:.|.:.....|            |||...:|:.   
  Rat    90 AVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMHSSE------------VGPFVSKIRAVIN 142

  Fly   143 -------PVVCGINGYCIANGLELALMCDLRVMEESAVLGFFNRRFGVPMLDAGTIRLPAMIGLS 200
                   |.:..|:|..:..||||||.||:||...||.:|....:..:.....||.|||..||::
  Rat   143 DIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMA 207

  Fly   201 RALDLILTGRPVGSQEAHDIGLVNRIVPTG----TALGNALELA 240
            .|.:||.:.|.:..|||..:||::.::...    .|...||:||
  Rat   208 LAKELIFSARVLDGQEAKAVGLISHVLEQNQEGDAAYRKALDLA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 59/207 (29%)
AuhXP_006253736.1 crotonase-like 62..315 CDD:329030 58/202 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.