DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and ech-2

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001255593.1 Gene:ech-2 / 3564942 WormBaseID:WBGene00001151 Length:297 Species:Caenorhabditis elegans


Alignment Length:306 Identity:78/306 - (25%)
Similarity:130/306 - (42%) Gaps:39/306 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FTAASRTFSSTKALHKDPATQEAEAAPPKNIL--VEKDKNI---TLIGINRP-QQRNAIDSLTAS 77
            |.::.|.||::||..   ...|.|.....:::  :..||.:   :|..||.. .:..|||.:   
 Worm     2 FKSSLRAFSTSKAAR---TLLERELYQGNSVVRFILNDKKVNTLSLAMINELFAELKAIDKI--- 60

  Fly    78 QLCDAFANFEADDTSPV--AVLYGVGGSFCSGFDILEIST----DEKEEISVDILMRPEGSVGPT 136
            :....:|..|.|.|..|  .::...|.||.:|.::.|::|    |:..||     ....|.:...
 Worm    61 EKVGVYAETEKDRTIKVRSVIIAHNGKSFSAGHELKELTTESGSDKHNEI-----FNTCGDMMNF 120

  Fly   137 RRQIKKPVVCGINGYCIANGLELALMCDLRVMEESA-------VLGFFNRRFGVPMLDAGTIRLP 194
            .|.:|.||:..:||...|.||:|...||:.|..:|:       .||.|....|:.::.|    :|
 Worm   121 IRNMKVPVIAEVNGTAAAAGLQLVASCDVVVAGKSSKFLVPGQKLGLFCSTPGIALVRA----VP 181

  Fly   195 AMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPTGTALGNALELATCLAKFPQRALIHDRNSVY 259
            ..:    |:|::||.:|:.|:.|...|||:|:|........||.:|..:..|.:......:...|
 Worm   182 RKV----AMDMLLTAQPIDSEAALRSGLVSRVVEDDQVKFEALNVAEQIGHFSRSVTALGKAFFY 242

  Fly   260 SSTFETSTFHQAVQNEVMFTSREIIEDMQNGIKWFNQTFKPDTTHS 305
            :.. |.||.........:......::|.|.||..|......|..|:
 Worm   243 TQA-ELSTVDAYRYGSRVMVGNLKLKDCQEGISAFIGKRPADFEHT 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 59/228 (26%)
ech-2NP_001255593.1 crotonase-like 17..284 CDD:304874 70/283 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.