DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and CG9577

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_608375.1 Gene:CG9577 / 33016 FlyBaseID:FBgn0031092 Length:312 Species:Drosophila melanogaster


Alignment Length:266 Identity:69/266 - (25%)
Similarity:117/266 - (43%) Gaps:25/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EAAPP---KNILVEKDKNITL-IGINRPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVGG 102
            |:.|.   |.:.|...|.... :.::||.:.|||......::.:.|.....:......||...|.
  Fly    33 ESGPTGSFKTLAVSSPKPFVFHVELHRPSKFNAISKQMWLEIKECFDGLATNPDCRAIVLSASGK 97

  Fly   103 SFCSGFDILEI--------STDE--KEEISVDILMRPEGSVGPTRRQIKKPVVCGINGYCIANGL 157
            .|.:|.|:.::        .||:  ::.:|::.:::.......:.....|||:..::..||..|:
  Fly    98 HFTAGIDLNDMINVGQTLAETDDYARKGVSMERMIKVYQDSISSLEHCPKPVITAVHKACIGAGV 162

  Fly   158 ELALMCDLRVMEESAVLGFFN-RRFGVPM-LDAGTI-RLPAMIG-LSRALDLILTGRPVGSQEAH 218
            :|....|:|...|.|   ||. :...:.| .|.||: |||..:| .|.|.:|..|||...:.|||
  Fly   163 DLITAADIRYCTEDA---FFQVKEVDIGMAADVGTLQRLPKAVGSQSLARELCFTGRKFEAAEAH 224

  Fly   219 DIGLVNRIVP-TGTALGNALELATCLA-KFPQRALIHDRNSVYS--STFETSTFHQAVQNEVMFT 279
            ..|||:|:.| ..:.|..||.:|..:| |.|........:.|||  .|.:....|..:.|::...
  Fly   225 SSGLVSRLFPDKDSLLTGALAVAELIASKSPVAVKTTKESLVYSLEHTNQEGLDHILLLNKLNLL 289

  Fly   280 SREIIE 285
            |.:..:
  Fly   290 SEDFAQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 59/226 (26%)
CG9577NP_608375.1 crotonase-like 52..310 CDD:304874 64/247 (26%)
PRK05617 54..309 CDD:235533 64/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.