DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and HADHA

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_000173.2 Gene:HADHA / 3030 HGNCID:4801 Length:763 Species:Homo sapiens


Alignment Length:331 Identity:87/331 - (26%)
Similarity:142/331 - (42%) Gaps:75/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VGQQARFTA---------ASRTFSSTKAL----HKDPATQEAEAAPPKNILVEKDKNITLIGINR 64
            :|..:||:|         ..|.|:.:.||    |             .|..|:.|  :.::.||.
Human     7 IGILSRFSAFRILRSRGYICRNFTGSSALLTRTH-------------INYGVKGD--VAVVRINS 56

  Fly    65 PQQR-NAIDSLTASQLCDAFANFEADDTSPVAVLY-GVGGSFCSGFDILEIST----DEKEEISV 123
            |..: |.:.....|:..:......|.|....|||. ...|.|.:|.||..::.    .|..::|.
Human    57 PNSKVNTLSKELHSEFSEVMNEIWASDQIRSAVLISSKPGCFIAGADINMLAACKTLQEVTQLSQ 121

  Fly   124 D---ILMRPEGSVGPTRRQIKKPVVCGINGYCIANGLELALMCDLRV--MEESAVLGFFNRRFGV 183
            :   |:.:.|.|.        ||:|..|||.|:..|||:|:.|..|:  .:...|||......|.
Human   122 EAQRIVEKLEKST--------KPIVAAINGSCLGGGLEVAISCQYRIATKDRKTVLGTPEVLLGA 178

  Fly   184 PMLDAGTIRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIV-PTGTAL--------GNALEL 239
            .....||.|||.|:|:..|||::||||.:.:..|..:|||:::| |.|..|        ....|:
Human   179 LPGAGGTQRLPKMVGVPAALDMMLTGRSIRADRAKKMGLVDQLVEPLGPGLKPPEERTIEYLEEV 243

  Fly   240 ATCLAK-------FPQR--ALIHDRNSVYSST--FETSTFHQAVQNEVMFTSR-------EIIED 286
            |...||       .|:|  .|: ::.:.|:.|  |.....::.|:.:|...::       :||:.
Human   244 AITFAKGLADKKISPKRDKGLV-EKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDV 307

  Fly   287 MQNGIK 292
            ::.||:
Human   308 VKTGIE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 68/238 (29%)
HADHANP_000173.2 fa_ox_alpha_mit 27..762 CDD:131494 83/311 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.