DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and Echdc2

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001100145.1 Gene:Echdc2 / 298381 RGDID:1308525 Length:296 Species:Rattus norvegicus


Alignment Length:233 Identity:75/233 - (32%)
Similarity:109/233 - (46%) Gaps:33/233 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ALHKDPATQEAEAAPPKNILVEKDKNITLIGINRPQQRNAIDSLTASQLCDAFANFEADDTSPVA 95
            |.|....|.|.:.    ..|...::.||.|.:|||..|||:.::..|:|.:|.|....|  ..|.
  Rat    24 AAHASTRTPEIQV----QALTGPNQGITEILMNRPHARNALGNVFVSELLEALAQLRED--QQVR 82

  Fly    96 VLY---GVGGSFCSGFDILEISTDEKEEISVDILMRPEGSVGPTRRQIK----------KPVVCG 147
            ||.   .|.|.||:|.|:     .|:|.:|.       ..||...::::          .|.:..
  Rat    83 VLLFRSAVKGVFCAGADL-----KERERMSA-------AEVGTFVQRLRGLMSEIAAFPAPTIAA 135

  Fly   148 INGYCIANGLELALMCDLRVMEESAVLGFFNRRFGVPMLDAGTIRLPAMIGLSRALDLILTGRPV 212
            ::|:.:..||||||.||||:...|||:|......|:.....||.|||..:|::.|.:||.|||.:
  Rat   136 MDGFALGGGLELALACDLRIAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRL 200

  Fly   213 GSQEAHDIGLVNRIVPTGTALGNALELATCLAK--FPQ 248
            ...:||::||||..|........|...|..||:  .||
  Rat   201 NGVQAHELGLVNHAVAQNEEGDAAYHRALALAQEILPQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 71/215 (33%)
Echdc2NP_001100145.1 crotonase-like 42..296 CDD:304874 70/211 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.