DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and Eci2

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001006967.1 Gene:Eci2 / 291075 RGDID:1359427 Length:391 Species:Rattus norvegicus


Alignment Length:307 Identity:78/307 - (25%)
Similarity:123/307 - (40%) Gaps:28/307 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLLAQQVGQQARFTAASRTFSSTKALHKDPATQEAEAAPPKNILVEKDKNITLIGINRPQQRNAI 71
            |.|.::..:|......|...||::|..:.....:.:|...|.|||..:..||.|..|||.::|||
  Rat    98 GSLPKETARQNYVDLVSSLSSSSEASSQGKGGADGKAQESKGILVTSEGGITKITFNRPSKKNAI 162

  Fly    72 DSLTASQLCDAFANFEADDTSPVAVLYGVGGSFCSGFDILEISTD----EKEEISVDILMRPEGS 132
            .......:..|..|...||| .:.|..|.|..:.||.|:...::.    |:......|::|   .
  Rat   163 TFQMYQDIILALKNASTDDT-VITVFTGAGDYYSSGNDLTNFTSASGGMEEAANKGAIVLR---E 223

  Fly   133 VGPTRRQIKKPVVCGINGYCIANGLELALMCDLRVMEESAVLGFFNRRFGVPMLDAG-------T 190
            ...|.....||:|..:||..:...:.|..:.|       ||.......|..|....|       :
  Rat   224 FVNTFIDFPKPLVAVVNGPAVGISVTLLGLFD-------AVYASDRATFHTPFSHLGQSPEACSS 281

  Fly   191 IRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPTGTALGNALELATCLAKFPQRALIHDR 255
            ...|.|:|.::|.:::|.|:.:.::||...|||..:.|..|............||.|..::...:
  Rat   282 YTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVWTRLKTYAKLPPNSMRISK 346

  Fly   256 NSVYSSTFETSTFHQAVQNEVMFT--SREIIEDMQNGIKWFNQTFKP 300
            ..:..:  |....| ||..|...|  :|.:.|:..|.|..| .|.||
  Rat   347 ELIRKN--EKEKLH-AVNEEECTTLRARWLSEECINAIMSF-VTRKP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 55/220 (25%)
Eci2NP_001006967.1 ACBP 38..113 CDD:279259 3/14 (21%)
Acyl-CoA binding. /evidence=ECO:0000250 64..68
crotonase-like 134..389 CDD:304874 69/269 (26%)
ECH-like 149..319 46/180 (26%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 196..200 2/3 (67%)
Microbody targeting signal. /evidence=ECO:0000255 389..391 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.