DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and HIBCH

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_055177.2 Gene:HIBCH / 26275 HGNCID:4908 Length:386 Species:Homo sapiens


Alignment Length:402 Identity:89/402 - (22%)
Similarity:158/402 - (39%) Gaps:59/402 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VGQQ------ARFTAASRTFSSTKALHKDPATQEAEAAPPKNILVEKDKNITLIGINRPQQRNAI 71
            :||:      :||.|..||   ...||....::..:||  :.:|:||.....:|.:|||:..||:
Human     1 MGQREMWRLMSRFNAFKRT---NTILHHLRMSKHTDAA--EEVLLEKKGCTGVITLNRPKFLNAL 60

  Fly    72 DSLTASQLCDAFANFEADDTSPVAVLYGVGG-SFCSGFDILEISTDEKEEISV-DILMRPEGSVG 134
            ......|:......:|.|..:.:.::.|.|| :||:|.||..||..||.:..: .:..|.|..:.
Human    61 TLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFREEYMLN 125

  Fly   135 PTRRQIKKPVVCGINGYCIANGLELALMCDLRVMEESAVLGFFNRRFGV-PMLDAGTI--RLPAM 196
            ......:||.|..|:|..:..|:.|::....||..|..:........|: |.:..|..  ||...
Human   126 NAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGGGYFLPRLQGK 190

  Fly   197 IGLSRALDLILTGRPVGSQEAHDIGLVNRIV-----------------PTGTALGNALELATCLA 244
            :|..    |.|||..:..::.:..|:....|                 |:...:.:.||.....:
Human   191 LGYF----LALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENIASVLENYHTES 251

  Fly   245 KF--PQRALIHDRNSVYSSTFETSTFHQAVQNEVMFTSREIIEDMQNGIKWFNQTFKPDTTHSWL 307
            |.  .:..::.:.....:|.|..:|..:.::|.....|...:|.    :|..|: ..|.:....|
Human   252 KIDRDKSFILEEHMDKINSCFSANTVEEIIENLQQDGSSFALEQ----LKVINK-MSPTSLKITL 311

  Fly   308 KRDRSMADWDDEEVAEAAAQKEKLKQE-------QEAALAEAEKQKQAEKAQKRSKK--TEE--- 360
               |.:.:...:.:.|....:.:|.|.       .|...|....:.|:.|.:....|  |||   
Human   312 ---RQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWKPADLKEVTEEDLN 373

  Fly   361 SAAESVDSKDPK 372
            :..:|:.|.|.|
Human   374 NHFKSLGSSDLK 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 52/233 (22%)
HIBCHNP_055177.2 PRK05617 34..378 CDD:235533 76/357 (21%)
ECH_2 47..375 CDD:292731 71/339 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.