DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and ECHS1

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_004083.3 Gene:ECHS1 / 1892 HGNCID:3151 Length:290 Species:Homo sapiens


Alignment Length:264 Identity:78/264 - (29%)
Similarity:125/264 - (47%) Gaps:22/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AEAAPPKNILVEK-DKNIT--LIGINRPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVGG 102
            |..|..:.|:.|| .||.|  ||.:|||:..||:......:|..|...||.|......||.|...
Human    28 ASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDK 92

  Fly   103 SFCSGFDILEISTDEKEEISVDILMRPEGSVGPTRRQIKKPVVCGINGYCIANGLELALMCDLRV 167
            :|.:|.||.|:.....::......::....:    .|:||||:..:|||....|.|||:|||:..
Human    93 AFAAGADIKEMQNLSFQDCYSSKFLKHWDHL----TQVKKPVIAAVNGYAFGGGCELAMMCDIIY 153

  Fly   168 MEESAVLGFFNRRFGVPMLDAGTI-------RLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNR 225
            ..|.|       :|..|.:..|||       ||...:|.|.|::::|||..:.:|:|...|||::
Human   154 AGEKA-------QFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSK 211

  Fly   226 IVPTGTALGNALELATCLAKFPQRALIHDRNSVYSSTFETSTFHQAVQNEVMFTSREIIEDMQNG 290
            |.|..|.:..|::.|..:|...:..:...:.|| ::.||.:....:...:.:|.|....:|.:.|
Human   212 ICPVETLVEEAIQCAEKIASNSKIVVAMAKESV-NAAFEMTLTEGSKLEKKLFYSTFATDDRKEG 275

  Fly   291 IKWF 294
            :..|
Human   276 MTAF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 68/219 (31%)
ECHS1NP_004083.3 crotonase-like 32..288 CDD:304874 76/260 (29%)
Substrate binding 98..101 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.