DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and ech-6

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001366674.1 Gene:ech-6 / 176376 WormBaseID:WBGene00001155 Length:288 Species:Caenorhabditis elegans


Alignment Length:320 Identity:88/320 - (27%)
Similarity:139/320 - (43%) Gaps:58/320 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRKFGGLLAQQVGQQARFTAASRTFSSTKALHKDPATQEAEAAPPKNILVEK---DKNITLIGIN 63
            :.:|..:|.:.....|..........|:||              |:.|.:||   .:|:.||.:|
 Worm     1 MMRFSSMLVRNAKLCANVNQMQVAAFSSKA--------------PEMIKIEKVGEKQNVALIKLN 51

  Fly    64 RPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVGGSFCSGFDILEISTDEKEEISVDILMR 128
            ||:..||:.:...::|.||....:.|.:....|:.|...:|.:|.||.|::.:|.........:.
 Worm    52 RPKALNALCAQLMTELADALEVLDTDKSVGAIVITGSERAFAAGADIKEMTNNEFATTFSGSFLS 116

  Fly   129 PEGSVGPTRRQIKKPVVCGINGYCIANGLELALMCDLRVMEESAVLGFFNRRFGVPMLDAGTI-- 191
            ...:|.    .:||||:..:||:.:..|.|||:|||:....|.|       |||.|.::.|||  
 Worm   117 NWTAVS----DVKKPVIAAVNGFALGGGNELAMMCDIIYAGEKA-------RFGQPEINIGTIPG 170

  Fly   192 -----RLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPTGTALGNALELATCLAKFPQRAL 251
                 |.....|.|.|:::.|||..|.:|||.:.|:|::|.|....:|.|::|...:|  .|..|
 Worm   171 AGGTQRWARAAGKSFAMEVCLTGNHVTAQEAKEHGIVSKIFPADQVVGEAVKLGEKIA--DQSPL 233

  Fly   252 IHDR-----NSVYSST------FETSTFHQAVQNEVMFTSREIIEDMQNGIKWFNQTFKP 300
            |...     |..|..|      ||...||      ..|.::    |.:.|:..|.:..||
 Worm   234 IVQMAKEAVNKAYELTLQEGLHFERRLFH------ATFATK----DRKEGMTAFAEKRKP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 69/224 (31%)
ech-6NP_001366674.1 crotonase-like 32..284 CDD:419961 81/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.