DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and ech-7

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_740932.1 Gene:ech-7 / 173300 WormBaseID:WBGene00001156 Length:256 Species:Caenorhabditis elegans


Alignment Length:258 Identity:78/258 - (30%)
Similarity:125/258 - (48%) Gaps:19/258 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KNITLIGINRPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVGGSFCSGFDILEISTDEKE 119
            :|:.||.:|||...||:......:|.:.....|.|.:..|.||.|...:|.:|.||.|::   |.
 Worm    11 ENVALITLNRPSALNALCRELMLELSENLLKVEKDQSYHVIVLTGSEKAFAAGADIKEMA---KL 72

  Fly   120 EISVDILMRPEGSVGPTRRQIKKPVVCGINGYCIANGLELALMCDLRVMEESAVLGFFNRRFGVP 184
            |.: |:......:...|...|.|||:..:||:.:..|.|||||||:....|:|:       ||.|
 Worm    73 EFA-DVFENDYFTNWDTLSHITKPVIAAVNGFALGGGTELALMCDIVYAGENAI-------FGQP 129

  Fly   185 MLDAGTI-------RLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPTGTALGNALELATC 242
            .:..|||       |.|..:..|.|:::.|:|..:|:|||.:.|||:::.|....:|.|:.||..
 Worm   130 EITIGTIPGLGGTQRWPRYVSKSVAMEICLSGDRLGAQEAKEDGLVSKVFPVQQLVGEAVLLADR 194

  Fly   243 LAKFPQRALIHDRNSVYSSTFETSTFHQAVQNEVMFTSREIIEDMQNGIKWFNQTFKPDTTHS 305
            :||.....:...:.|: :|.::||........:.:|.|.....|.:.|:..|.:...|..|.|
 Worm   195 IAKNSPLIVKTVKRSL-NSAYQTSLNQGLEMEKQLFQSTFATNDRREGMSAFAEKRAPKWTSS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 67/210 (32%)
ech-7NP_740932.1 crotonase-like 12..254 CDD:304874 76/253 (30%)
PRK05617 13..253 CDD:235533 75/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.