DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and Hadha

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_570839.2 Gene:Hadha / 170670 RGDID:620512 Length:763 Species:Rattus norvegicus


Alignment Length:353 Identity:88/353 - (24%)
Similarity:146/353 - (41%) Gaps:54/353 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AQQVGQQARFTAASRTFSSTKALHKDPATQEAEAAPPKNILVEKDKNITLIGINRPQQR-NAIDS 73
            ::.:|..:||:|.....|.....|....:....:....|..|:.|  :.:|.||.|..: |.::.
  Rat     4 SRAIGSLSRFSAFRILRSRGCICHSFTTSSALLSRTHINYGVKGD--VAVIRINSPNSKVNTLNK 66

  Fly    74 LTASQLCDAFANFEADDTSPVAVLY-GVGGSFCSGFDI--LEISTDEKEEISVDILMRPEG-SVG 134
            ...|:..:......|:|....|||. ...|.|.:|.||  |...|..:|...:.    .|| .:.
  Rat    67 EVQSEFVEVMNEIWANDQIRSAVLISSKPGCFVAGADINMLASCTTPQEAARIS----QEGQKMF 127

  Fly   135 PTRRQIKKPVVCGINGYCIANGLELALMCDLRV--MEESAVLGFFNRRFGVPMLDAGTIRLPAMI 197
            ....:..||||..|:|.|:..|||||:.|..|:  .:...|||......|:.....||.|||.|:
  Rat   128 EKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLGVPEVLLGILPGAGGTQRLPKMV 192

  Fly   198 GLSRALDLILTGRPVGSQEAHDIGLVNRIV-PTG----------------TALGNALELATCLAK 245
            |:..|.|::||||.:.:..|..:|||:::| |.|                .|:..|..||.....
  Rat   193 GVPAAFDMMLTGRNIRADRAKKMGLVDQLVDPLGPGIKSPEERTIEYLEEVAVNFAKGLADRKVS 257

  Fly   246 FPQRALIHDRNSVYSST--FETSTFHQAVQNEVMFTSR-------EIIEDMQNGIKWFNQTFKPD 301
            ..|...:.::.:.|:.|  |.....::.|:.:|...::       :||:.::.|::..|..    
  Rat   258 AKQSKGLMEKLTSYAMTIPFVRQQVYKTVEEKVKKQTKGLYPAPLKIIDAVKTGLEQGNDA---- 318

  Fly   302 TTHSWLKRDRSMADWDDEEVAEAAAQKE 329
               .:|.        :.|:..|.|..||
  Rat   319 ---GYLA--------ESEKFGELALTKE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 66/233 (28%)
HadhaNP_570839.2 fa_ox_alpha_mit 29..762 CDD:131494 82/328 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.