DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and Cdyl

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034011.1 Gene:Cdyl / 12593 MGIID:1339956 Length:593 Species:Mus musculus


Alignment Length:204 Identity:55/204 - (26%)
Similarity:96/204 - (47%) Gaps:10/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KNILVEKDKNITLIGIN-RPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVGGSFCSGFDI 110
            ::|:|.|....|.|.:: :..:.|:::.....::..|.:...||| |.:.:|..||..||.|.|.
Mouse   337 RDIVVRKQDGFTHILLSTKSSENNSLNPEVMKEVQSALSTAAADD-SKLVLLSAVGSVFCCGLDF 400

  Fly   111 LEI---STDEKEEISVDILMRPEGSVGPTRRQIKKPVVCGINGYCIANGLELALMCDLRVMEESA 172
            :..   .||:::..|..:.......|. |..|.|||::..:||..|..|..:..:||:....|.|
Mouse   401 IYFIRRLTDDRKRESTKMADAIRNFVN-TFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKA 464

  Fly   173 VLGFFNRRFGVPMLDAGTIRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPTGTALGNAL 237
            ........||.......|:..|.::|.:.|.:::.:||.:.:|||...|||:::...||.....:
Mouse   465 WFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLFSGRKLTAQEACGKGLVSQVFWPGTFTQEVM 529

  Fly   238 ----ELATC 242
                |||:|
Mouse   530 VRIKELASC 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 55/202 (27%)
CdylNP_034011.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
CHROMO 55..109 CDD:214605
Interaction with EZH2. /evidence=ECO:0000250|UniProtKB:Q9Y232 56..304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..223
crotonase-like 339..535 CDD:119339 51/197 (26%)
Acetyl-CoA-binding domain. /evidence=ECO:0000255 357..589 50/184 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.