Sequence 1: | NP_650199.1 | Gene: | Srlp / 41533 | FlyBaseID: | FBgn0038049 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034011.1 | Gene: | Cdyl / 12593 | MGIID: | 1339956 | Length: | 593 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 55/204 - (26%) |
---|---|---|---|
Similarity: | 96/204 - (47%) | Gaps: | 10/204 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 KNILVEKDKNITLIGIN-RPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVGGSFCSGFDI 110
Fly 111 LEI---STDEKEEISVDILMRPEGSVGPTRRQIKKPVVCGINGYCIANGLELALMCDLRVMEESA 172
Fly 173 VLGFFNRRFGVPMLDAGTIRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPTGTALGNAL 237
Fly 238 ----ELATC 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Srlp | NP_650199.1 | crotonase-like | 49..259 | CDD:304874 | 55/202 (27%) |
Cdyl | NP_034011.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..30 | ||
CHROMO | 55..109 | CDD:214605 | |||
Interaction with EZH2. /evidence=ECO:0000250|UniProtKB:Q9Y232 | 56..304 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 110..158 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 200..223 | ||||
crotonase-like | 339..535 | CDD:119339 | 51/197 (26%) | ||
Acetyl-CoA-binding domain. /evidence=ECO:0000255 | 357..589 | 50/184 (27%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1024 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |