DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and CDYL2

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_011521168.1 Gene:CDYL2 / 124359 HGNCID:23030 Length:540 Species:Homo sapiens


Alignment Length:274 Identity:66/274 - (24%)
Similarity:117/274 - (42%) Gaps:64/274 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KNILVEKDKNITLIGI-NRPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVGGSFCSGFD- 109
            ::|:|.|::..|.|.: ::....||:......::..|..|...|| |.:.:|..||..||||.| 
Human   284 RDIVVRKEEGFTHILLSSQTSDNNALTPEIMKEVRRALCNAATDD-SKLLLLSAVGSVFCSGLDY 347

  Fly   110 ---ILEISTDEKEEISVDILMRPEGSVGPTRR-------QIKKPVVCGINGYCIANGLELALMCD 164
               |..:|:|.::|.:         .:....|       |.|||:|..|||..:..|..:..:||
Human   348 SYLIGRLSSDRRKEST---------RIAEAIRDFVKAFIQFKKPIVVAINGPALGLGASILPLCD 403

  Fly   165 LRVMEESAVLGFFNRRFGVPMLDAGTIRL----------PAMIGLSRALDLILTGRPVGSQEAHD 219
            :....|.|       .|..|.   .||||          |.::|::.|.:::..||.:.:|||..
Human   404 IVWASEKA-------WFQTPY---ATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQEACS 458

  Fly   220 IGLVNRIV-PT-------------GTALGNALELATCLAKFPQRALIHDRN--------SVYSST 262
            .|||:::. ||             .:.....||.:.||.:...::::.|.|        .::||:
Human   459 RGLVSQVFWPTTFSQEVMLRVKEMASCSAVVLEESKCLVRSFLKSVLEDVNEKECLMLKQLWSSS 523

  Fly   263 FETSTFHQAVQNEV 276
            ....:....:|:::
Human   524 KGLDSLFSYLQDKI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 63/253 (25%)
CDYL2XP_011521168.1 CHROMO 40..89 CDD:214605
crotonase-like 286..482 CDD:119339 57/215 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.