DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and Auh

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_057918.2 Gene:Auh / 11992 MGIID:1338011 Length:314 Species:Mus musculus


Alignment Length:239 Identity:69/239 - (28%)
Similarity:105/239 - (43%) Gaps:36/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ARFTAASRTFSSTKALHKDPATQEAEAAPPKNILVEKDKNITLIGINRPQQRNAIDSLTASQLCD 81
            ||.||..|.:||......:...:..|         |:::.|.::||||...:||:.......|..
Mouse    33 ARGTAPRRGYSSEVKTEDELRVRHLE---------EENRGIVVLGINRAYGKNALSKNLLKMLSK 88

  Fly    82 AFANFEAD-DTSPVAVLYGVGGSFCSGFDILEISTDEKEEISVDILMRPEGSVGPTRRQIKK--- 142
            |....::| ....:.:...|.|.||:|.|:.|.:.....|            |||...:|:.   
Mouse    89 AVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMHSSE------------VGPFVSKIRSVIN 141

  Fly   143 -------PVVCGINGYCIANGLELALMCDLRVMEESAVLGFFNRRFGVPMLDAGTIRLPAMIGLS 200
                   |.:..|:|..:..||||||.||:||...||.:|....:..:.....||.|||..||:|
Mouse   142 DIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMS 206

  Fly   201 RALDLILTGRPVGSQEAHDIGLVNRIVPTG----TALGNALELA 240
            .|.:||.:.|.:..|||..:||::.::...    .|...||:||
Mouse   207 LAKELIFSARVLDGQEAKAVGLISHVLEQNQEGDAAYRKALDLA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 61/207 (29%)
AuhNP_057918.2 crotonase-like 61..314 CDD:304874 60/202 (30%)
RNA-binding. /evidence=ECO:0000250|UniProtKB:Q13825 80..94 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.