DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and ATG7

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_012041.1 Gene:ATG7 / 856576 SGDID:S000001214 Length:630 Species:Saccharomyces cerevisiae


Alignment Length:362 Identity:63/362 - (17%)
Similarity:120/362 - (33%) Gaps:116/362 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VVDMDTSETAVELTEAENELYDRQIRLWGLESQKRL---RTAKILIAGLCGLGAEITKNIILSGV 63
            |||:.:....:::.:...:| :.::..|.:.....|   :..|:|:.|...||..:::.:|..||
Yeast   285 VVDLSSLLDPLKIADQSVDL-NLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGV 348

  Fly    64 NSVKLLDDKDVTEEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQ 128
            ..:..:|:..|:..:...|.|...|.....:||.:....:.:.|::|.:                
Yeast   349 RKITFVDNGTVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDAT---------------- 397

  Fly   129 FDVVVVNGATNEELLRIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDVIKHKVVANSEKK 193
                                    |||...                     .:|.||:|....:.
Yeast   398 ------------------------GVKLSI---------------------PMIGHKLVNEEAQH 417

  Fly   194 KKYETV-SIPTQRDVDYPGYSAWLDFDVTEPSYLRKLKRNGPGVLLLSVLQKFRTTHKRDPSYKT 257
            |.::.: ::..:.|:      .:|..|..|..:|..|..|.....:::....|       .||  
Yeast   418 KDFDRLRALIKEHDI------IFLLVDSRESRWLPSLLSNIENKTVINAALGF-------DSY-- 467

  Fly   258 READLELLRGIRDE--------------LLPNSILGDEALGLIFAQISPAVAVVGGVVAQEVIK- 307
                |.:..|.|||              :.|...|.|..|..:.....|.||::...:|.|::. 
Yeast   468 ----LVMRHGNRDEQSSKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTS 528

  Fly   308 -VVTKL---------EAPHR------NLFVFDPETCA 328
             :.||.         :.||:      |..:...||.|
Yeast   529 LLQTKYSGSETTVLGDIPHQIRGFLHNFSILKLETPA 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 23/155 (15%)
ThiF 22..>167 CDD:279270 22/147 (15%)
ATG7NP_012041.1 E1_like_apg7 9..628 CDD:273590 63/362 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.