DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and UBA4

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_011979.1 Gene:UBA4 / 856511 SGDID:S000001153 Length:440 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:36/159 - (22%)
Similarity:69/159 - (43%) Gaps:8/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LTEAENELYDRQI---RLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVT 75
            |:..|.:.|.||:   ...|:..|.:|:..|:|:.|..|||......:..:||..:.::|:..|.
Yeast    39 LSLEEYQRYGRQMIVEETGGVAGQVKLKNTKVLVVGAGGLGCPALPYLAGAGVGQIGIVDNDVVE 103

  Fly    76 EEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQF-DVVVVNGATN 139
            ..:...|.|.....:...:.|::......|||.:::..  .|::..:|..|..| ....:...|:
Yeast   104 TSNLHRQVLHDSSRVGMLKCESARQYITKLNPHINVVT--YPVRLNSSNAFDIFKGYNYILDCTD 166

  Fly   140 EELLR--IDTICRDLGVKFIATDVWGTFG 166
            ..|.|  :..:..:||:..::....||.|
Yeast   167 SPLTRYLVSDVAVNLGITVVSASGLGTEG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 34/154 (22%)
ThiF 22..>167 CDD:279270 34/151 (23%)
UBA4NP_011979.1 ThiF_MoeB_HesA_family 46..279 CDD:238386 34/152 (22%)
RHOD_ThiF 316..440 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.