DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and ULA1

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_015322.1 Gene:ULA1 / 856104 SGDID:S000005924 Length:462 Species:Saccharomyces cerevisiae


Alignment Length:484 Identity:99/484 - (20%)
Similarity:152/484 - (31%) Gaps:214/484 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ELYDRQIRLWGLESQKRLRTAKILIAG-LCGLGAEITKNIILSGVNSVKLLDDKDVTEEDFCSQF 83
            |.||||:||||...|..|..:::.:.| ...|..|:.||::|:|::|:..|              
Yeast     2 ERYDRQLRLWGALGQDSLNRSRVCVVGPATPLLQEVFKNLVLAGISSLTWL-------------- 52

  Fly    84 LVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEF---------------FGQFDVVV 133
                      :.|.::......  :.::..|.|||..|..|:               :.:|.||:
Yeast    53 ----------KVECAVQSGSLF--LAELKKDLEPLASKQLEYEENDLRKTLQQPQYDWTRFSVVI 105

  Fly   134 VNGATNEE--LLRIDTICRDLGVKF---IATDVWGTFGFYFA-------SLQKH----------- 175
            :. ...|:  :|.::.|.|..|.||   :.|.|.|.:|:.:.       .||.|           
Yeast   106 LT-CIGEQTAMLDLNEIRRQRGTKFPPVLNTFVSGFYGYIYLVLSETHFVLQAHPDSKKYDLRLQ 169

  Fly   176 -------SYVE-----------------DVIKHKVVANSEK------------KKKYETVSIPTQ 204
                   :||:                 .|:..|.:|..|:            ||..:.:.:|..
Yeast   170 NPWPELINYVDTFDLSKMDTATFSGIPYTVLLMKCIAKLERDGNNGRITIDQMKKVLDQICLPLG 234

  Fly   205 RDVDY-PGY-----SAWL----------------------------------------------- 216
            .||.| |.|     .|:|                                               
Yeast   235 NDVIYEPNYVEAKRYAYLACSQNDCCKELEDLLRNLEISDYGNDWHDTYNYEILTLLLTLKNIAK 299

  Fly   217 ---------------DFDVTEPSYLRKLKRNGPGVLLLSV---LQKFRTTHKRDPSYKTREAD-L 262
                           |.:.|..:|:| ||:      |..|   |.|.|.......|.|....| |
Yeast   300 ENGELSFQPLTGTLPDMESTTENYIR-LKK------LYEVKAKLDKSRVEESLARSKKIVSQDVL 357

  Fly   263 ELLRG----IRDELLPNS-ILG----------------------------DEALGLIFAQISPAV 294
            |....    :|..|.|.| :||                            ||.:||........:
Yeast   358 ETFCSHYGEVRKILPPKSDLLGIFSTSNALLDALVMVQFWEQPAVTAEDKDEFIGLRVDDNYSVM 422

  Fly   295 AVVGGVVAQEVIKVVTKLEAPHRNLFVFD 323
            |..||.|.||.||::|....|..|||:::
Yeast   423 AFFGGAVVQEAIKLITHHYVPIDNLFLYN 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 41/179 (23%)
ThiF 22..>167 CDD:279270 39/165 (24%)
ULA1NP_015322.1 E1_enzyme_family 2..460 CDD:304554 99/484 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1600
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.