DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and TCD2

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_012898.1 Gene:TCD2 / 853841 SGDID:S000001510 Length:447 Species:Saccharomyces cerevisiae


Alignment Length:349 Identity:72/349 - (20%)
Similarity:130/349 - (37%) Gaps:94/349 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YDRQ---------IRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEE 77
            ||.|         :...|.::.::|....:::.|..|:|:.:..:::.||...::::|...|:..
Yeast    60 YDEQFIRQSLKNNVEFLGEDTIEKLSNQYVVVVGAGGVGSWVVNSLVRSGCRKIRVVDFDQVSLS 124

  Fly    78 DFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQFDVVVVNGATNEEL 142
            ............:.|.:.|......|.:.|..:|    :|:.|..:...|: .:.:.||..:..:
Yeast   125 SLNRHSCAILNDVGTPKVECLRRHMREIAPWCEI----DPINELWTLQNGE-RLTLGNGTPDFIV 184

  Fly   143 LRIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDVIKHKVVANSEKKKKYETVSIPTQRDV 207
            ..||.|  |..|                .|.:.:|...:   ||:::.....|    |.||:.:|
Yeast   185 DCIDNI--DTKV----------------DLLEFAYNHGI---KVISSMGASAK----SDPTKLNV 224

  Fly   208 DYPGYSAWLDFDVTEPSYL-----RKLKRNGPGVLLLSVLQKFRTTHKRDP-----------SYK 256
            .        |...||...|     ||||:.|    :||.:....:..|.||           .|:
Yeast   225 G--------DLATTEEDPLARVVRRKLKKRG----ILSGIPVVFSAEKPDPKKAKLLPLPDEEYE 277

  Fly   257 TREAD-LELLRGIRDELLPNSILG--DEALGL-----IFAQISPAVAVVGGVVAQEVIKVVTKLE 313
            ..:.| |..|:..|..:||  :||  ....||     |.:.||.              |.:..:|
Yeast   278 RGKVDELSALKDFRVRILP--VLGTMPSLFGLTITTWILSNISD--------------KPLEPVE 326

  Fly   314 APHRNLFVFDP--ETCAGYVEAIG 335
            ..:| :.|:|.  ::.||.:..:|
Yeast   327 GKNR-IKVYDGIYQSLAGQMSRVG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 27/158 (17%)
ThiF 22..>167 CDD:279270 27/153 (18%)
TCD2NP_012898.1 TcdA 63..325 CDD:224100 63/319 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.