DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and Nae1

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_114461.3 Gene:Nae1 / 84019 RGDID:619945 Length:534 Species:Rattus norvegicus


Alignment Length:259 Identity:69/259 - (26%)
Similarity:118/259 - (45%) Gaps:29/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ENELYDRQIRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEEDFCSQ 82
            :.:.||||:||||...|:.|.:|.:.:......|.||.||::|.|:.|..::|...|:.||..:.
  Rat     9 KEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDVGNN 73

  Fly    83 FLVPRESLNTNRAEASLTRARALNPMVD---ISADREPLKEKTSEFFGQFDVVVVNGATNEELLR 144
            |.:.:.|:..|||:|::...:.||..|.   :....|.|.:....||.:|.:||........|||
  Rat    74 FFLQKCSIGKNRAQAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTIVVATQLLESTLLR 138

  Fly   145 IDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDVIKHKVVANSEKKKKYETVSI----PTQR 205
            :..:..:..:..:....:|..|          |:..:||...|..|......|.:.:    |..|
  Rat   139 LADVLWNSQIPLLICRTYGLVG----------YMRIIIKEHPVIESHPDNALEDLRLDKPFPELR 193

  Fly   206 DVDYPGYSAWLDFDVTEPSYLRKLKRNGPGVLLLS--VLQKFRTTHKRDP-SYKTREADLELLR 266
            : .:..|    |.|..|    :|...:.|.:::::  :.|.:..|:.|.| |||.:|...||:|
  Rat   194 E-HFQSY----DLDHME----KKDHSHTPWIVIIAKYLAQWYSETNGRIPKSYKEKEDFRELIR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 44/155 (28%)
ThiF 22..>167 CDD:279270 43/147 (29%)
Nae1NP_114461.3 ThiF 9..>193 CDD:223552 51/193 (26%)
APPBP1_RUB 11..532 CDD:238770 69/257 (27%)
Interaction with UBA3. /evidence=ECO:0000250 331..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.