DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and UBA5

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_079094.1 Gene:UBA5 / 79876 HGNCID:23230 Length:404 Species:Homo sapiens


Alignment Length:318 Identity:68/318 - (21%)
Similarity:113/318 - (35%) Gaps:82/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VELTEAENELYDRQ-------IRLWGLESQ-KRLRTAKILIAGLCGLGAEITKNIILSGVNSVKL 68
            |.:.:..:|:.|..       ::..|:.|. :::||..:.|.|:.|:|:...:.:...|:..:.|
Human    38 VRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLL 102

  Fly    69 LDDKDVTEEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQFDVVV 133
            .|...|...:....|..|.:: ..::.:|:....|.:||  |:..:.......|.|.|..|...:
Human   103 FDYDKVELANMNRLFFQPHQA-GLSKVQAAEHTLRNINP--DVLFEVHNYNITTVENFQHFMDRI 164

  Fly   134 VNGATN---------------EELLRIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDVIK 183
            .||...               |..:.|:|.|.:||      ..|...|....::..|  ::.:|.
Human   165 SNGGLEEGKPVDLVLSCVDNFEARMTINTACNELG------QTWMESGVSENAVSGH--IQLIIP 221

  Fly   184 HK-----------VVAN-SEKKKKYETV---SIPTQRDV--------------------DYPGYS 213
            .:           |.|| .||..|.|.|   |:||...|                    .|.||:
Human   222 GESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVSFYLGYN 286

  Fly   214 AWLDFDVTEPSYLRKLKRNGPGVLLLSVLQKFRTTHKRDPSYKTREADLELLRGIRDE 271
            |..||..|     ..:|.| |..       ..|...|:...||.:.|.|.....|::|
Human   287 AMQDFFPT-----MSMKPN-PQC-------DDRNCRKQQEEYKKKVAALPKQEVIQEE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 35/175 (20%)
ThiF 22..>167 CDD:279270 33/167 (20%)
UBA5NP_079094.1 ThiF_MoeB_HesA_family 52..297 CDD:238386 54/260 (21%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000269|PubMed:26929408, ECO:0000269|PubMed:27653677 334..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.