DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and UBA7

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_003326.2 Gene:UBA7 / 7318 HGNCID:12471 Length:1012 Species:Homo sapiens


Alignment Length:432 Identity:115/432 - (26%)
Similarity:173/432 - (40%) Gaps:108/432 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MDTSETAVELTEAENELYDRQIRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLL 69
            ||..:.:..|.|   |||.||:.:.|..:.:|::.|::|::||.|||||:.||::|.||.|:.|.
Human     1 MDALDASKLLDE---ELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLTLH 62

  Fly    70 DDKDVTEEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQFDVVVV 134
            |.......|..:|||:..:.|..:|||||......||..|.:......:   |.:....|.|||:
Human    63 DPHPTCWSDLAAQFLLSEQDLERSRAEASQELLAQLNRAVQVVVHTGDI---TEDLLLDFQVVVL 124

  Fly   135 NGATNEELLRIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDVIKHKVVANSEKKKKYETV 199
            ..|..||.|::.|:|...||.|:|.|..|..|..|....:...|:|..:.:.:..:.:.....:.
Human   125 TAAKLEEQLKVGTLCHKHGVCFLAADTRGLVGQLFCDFGEDFTVQDPTEAEPLTAAIQHISQGSP 189

  Fly   200 SIPTQRD------------VDYPGYSAWLDFDVTEP--------------------SYLR----- 227
            .|.|.|.            |.:.|....::.:..:|                    .|||     
Human   190 GILTLRKGANTHYFRDGDLVTFSGIEGMVELNDCDPRSIHVREDGSLEIGDTTTFSRYLRGGAIT 254

  Fly   228 KLKRN-------------GPGVLLLS---------------VLQKFRTTHKRDPS-YKTREA--- 260
            ::||.             .|.|:..|               .|.||:..|.|.|. :...:|   
Human   255 EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETV 319

  Fly   261 -----DLELLRGIRDELLPNSILGDEALGLIFA-----QISPAVAVVGGVVAQEVIKVVTKLEAP 315
                 |||.|:...:|.|...:  ||||....|     .:||.||::|.|.||||:|.:::...|
Human   320 VGLARDLEPLKRTEEEPLEEPL--DEALVRTVALSSAGVLSPMVAMLGAVAAQEVLKAISRKFMP 382

  Fly   316 HRNLFVFD--------------PETCA-------GYVEAIGA 336
            ......||              ||.||       |.:...||
Human   383 LDQWLYFDALDCLPEDGELLPSPEDCALRGSRYDGQIAVFGA 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 56/152 (37%)
ThiF 22..>167 CDD:279270 52/144 (36%)
UBA7NP_003326.2 ThiF 10..1010 CDD:330201 113/423 (27%)
2 approximate repeats 23..575 106/407 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.