DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and UBA1

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_016885266.1 Gene:UBA1 / 7317 HGNCID:12469 Length:1109 Species:Homo sapiens


Alignment Length:413 Identity:110/413 - (26%)
Similarity:159/413 - (38%) Gaps:101/413 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VVDMDTSETAVELTEAENE--LYDRQIRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVN 64
            |..:.|:..|...:||:.:  ||.||:.:.|.|:.|||:|:.:|::||.|||.||.|||||.||.
Human    84 VPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVK 148

  Fly    65 SVKLLDDKDVTEEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQF 129
            :|.|.|.......|..|||.:..|.:..||||.|..|...||..|.::|...||.|   :|...|
Human   149 AVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVE---DFLSGF 210

  Fly   130 DVVVVNGATNEELLRIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDVIKHKVVANSEKKK 194
            .|||:.....|:.||:...|.:.|:|.:..|..|.||..|....:...:.|       :|.|:..
Human   211 QVVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTD-------SNGEQPL 268

  Fly   195 KYETVSIPTQRDVDYPGYSAWLD--------------------------------------FDVT 221
            . ..||:.|:   |.||....||                                      |.:.
Human   269 S-AMVSMVTK---DNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSIC 329

  Fly   222 EPS----YLR---------------------------------KLKRNGPGVLLLSVLQKFRTTH 249
            :.|    |:|                                 |..|.....:....|.:|...|
Human   330 DTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQH 394

  Fly   250 KRDPSYKTREADLELL---RGIRDELLP----NSILGDEALGLIF---AQISPAVAVVGGVVAQE 304
            .|.|..:..|...||:   :.:....||    |::..|....|.:   ..::|..|.:||:.|||
Human   395 GRPPRPRNEEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQE 459

  Fly   305 VIKVVTKLEAPHRNLFVFDPETC 327
            |:|..:....|......||...|
Human   460 VMKACSGKFMPIMQWLYFDALEC 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 62/154 (40%)
ThiF 22..>167 CDD:279270 59/144 (41%)
UBA1XP_016885266.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.