DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and nae1

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_956793.1 Gene:nae1 / 573336 ZFINID:ZDB-GENE-040426-1552 Length:533 Species:Danio rerio


Alignment Length:335 Identity:80/335 - (23%)
Similarity:141/335 - (42%) Gaps:72/335 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AENELYDRQIRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEEDFCS 81
            ::.:.||||:||||...|:.|..|.:.:......|.||.||::|.|:.:..::|...|:.||..:
Zfish     7 SKEQRYDRQLRLWGDHGQEALENAHVCLINATASGTEILKNLVLPGIGAFTIVDGHKVSGEDVGN 71

  Fly    82 QFLVPRESLNTNRAEASLTRARALNP-----MVDISADREPLKEKTSEFFGQFDVVVVNGATNEE 141
            .|.:...::..|||:|:....:.||.     .|:.|.|:  |.:...|||.:|.:|:........
Zfish    72 NFFLSSSAIGKNRAQAATELLQELNSDVSGNFVEESPDK--LLDNDCEFFHRFSLVIAVQLPEST 134

  Fly   142 LLRIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDVIKHKVVA---------NSEKKKKYE 197
            .|.:..:..:.||.|:....:|..|:....:::|:.||   .|...|         .:|.|:..|
Zfish   135 CLGLGAVLWEAGVPFLVCRTYGLIGYMRLIVKEHTVVE---SHPDNALEDLRLDQPFTELKRHVE 196

  Fly   198 TVSIPTQRDVDYPGYSAWLDFDVTEPSYLRK-LKRNGPGVLLLSVLQKFRTTHKRDPSYKTREAD 261
            :..:......|: .::.|:   :....||.| ...|.      |.|.|         :||.:||.
Zfish   197 SYDLDNMEKKDH-SHTPWI---IVVARYLEKWYNENN------SQLPK---------NYKEKEAF 242

  Fly   262 LELLR---------GIRDELLPNSILGDEALGLIFAQISPAVAVVGGVVAQEVIKVVTKLEAPHR 317
            .:|||         |:.||  .|.   :||:..:...::|                 ||:.:..:
Zfish   243 RQLLREGILKNENGGLEDE--ENF---EEAIKNVNTALNP-----------------TKISSGTQ 285

  Fly   318 NLFVFDPETC 327
            :  :|:.|.|
Zfish   286 D--IFNAEQC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 44/157 (28%)
ThiF 22..>167 CDD:279270 43/149 (29%)
nae1NP_956793.1 ThiF 6..>164 CDD:223552 44/158 (28%)
APPBP1_RUB 10..531 CDD:238770 80/332 (24%)
Interaction with uba3. /evidence=ECO:0000250 330..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1600
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.