DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and Uba2

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster


Alignment Length:185 Identity:48/185 - (25%)
Similarity:88/185 - (47%) Gaps:31/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEEDFCSQFLVPRESLNTNRAEAS 98
            |:.::.:|:|:.|..|:|.|:.||::|||...::::|...:...:...|||..||.:..::|..:
  Fly    14 QELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVA 78

  Fly    99 LTRARALNPMVDISADREPLKEKTS-----EFFGQFDVVVVNGATNEELLR--IDTICRDLGVKF 156
            ...|.:.||...|:|..:.:   ||     .||.:||:|:  .|.:....|  ::.:|.:..|..
  Fly    79 RESALSFNPDAKITAYHDSV---TSTDYGVNFFKKFDLVL--SALDNRAARNHVNRMCLNADVPL 138

  Fly   157 IATDVWGTFGFYFASLQKHSYVEDVIKHKVVANSEKKKKYETVSIPTQRDVDYPG 211
            |.:   ||.|:       :..|| :||..:.      :.||..  |..:...:||
  Fly   139 IES---GTAGY-------NGQVE-LIKRGLT------QCYECT--PKDKQRSFPG 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 39/144 (27%)
ThiF 22..>167 CDD:279270 38/139 (27%)
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 48/185 (26%)
Uba2_SUMO 21..459 CDD:238766 47/178 (26%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446844
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.