DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and mocs3

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_956421.1 Gene:mocs3 / 393095 ZFINID:ZDB-GENE-040426-782 Length:459 Species:Danio rerio


Alignment Length:408 Identity:83/408 - (20%)
Similarity:143/408 - (35%) Gaps:138/408 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TSETAVELTEAENE----LYDRQIRL--WGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNS 65
            ||.:.:.|..:.|.    .|.||:.|  .|::.|..:....:|:.|..|||..:.:.:..:|:..
Zfish    44 TSLSPLRLNTSLNNDDIMRYSRQLLLPELGVKGQIAISNISVLVVGCGGLGCPLAQYLAAAGIGR 108

  Fly    66 VKLLDDKDVTEEDFCSQFLVPRESLNTNRAEA---SLTRARALNPM----------VDISADREP 117
            :.|| |.||.|..     .:.|:.|:|...:.   :|:.|:|::.|          :.:|     
Zfish   109 LGLL-DYDVVELS-----NLHRQVLHTELTQGQPKALSAAQAISRMNSTVQCVPYHLQLS----- 162

  Fly   118 LKEKTSEFFGQFDVV-----------VVNGA---TNEEL-----LRID----------------- 146
             :|...:...|:|:|           :||.|   |:..|     ||::                 
Zfish   163 -RENAIQLIQQYDIVADCSDNVPTRYLVNDACVLTSRPLVSASALRMEGQLTVYNYRGGPCYRCL 226

  Fly   147 ----------TICRDLGVKFIATDVWGTFG----FYFASLQKHSYVEDVIK--------HKVVAN 189
                      |.|.|.||..:...:.|...    ...||.|:.|:.:.::.        ..:...
Zfish   227 YPIPPPPETVTNCSDGGVLGVVPGIMGCLQALEVLKIASGQECSFAQQLLMFDGEQTRFRSIRLR 291

  Fly   190 SEKKKKYETVSIPTQRDV-DYPGY--SAWLDFDVTEPSYLRKLKRNGPGVLLLSVLQKFRTTHKR 251
            |.:|:.......||..:: ||..:  ||..|          |.:|       |.:|.:.:....:
Zfish   292 SRQKECVVCGEKPTITELQDYEHFCGSAATD----------KCRR-------LHLLSREQRVSVQ 339

  Fly   252 DPSYKTREADLELLRGIRDELLPNSILGDEALGLIFAQISPAVAVVGGVVAQEVIKVVTKLEAPH 316
            |  ||          ||.|...|:.:|          .:.|.|.|       ::.::...|..|.
Zfish   340 D--YK----------GILDHSTPHLLL----------DVRPKVEV-------DICRLSNSLHIPL 375

  Fly   317 RNLFVFDPETCAGYVEAI 334
            .:|....||......|||
Zfish   376 ASLEDKKPEHITLLKEAI 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 45/221 (20%)
ThiF 22..>167 CDD:279270 43/209 (21%)
mocs3NP_956421.1 PRK07411 46..459 CDD:180967 81/406 (20%)
ThiF_MoeB_HesA_family 62..290 CDD:238386 47/239 (20%)
RHOD_ThiF 327..459 CDD:238784 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.