DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and Uba1

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001014102.1 Gene:Uba1 / 314432 RGDID:1359327 Length:1058 Species:Rattus norvegicus


Alignment Length:404 Identity:106/404 - (26%)
Similarity:158/404 - (39%) Gaps:83/404 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VVDMDTSETAVELTEA--ENELYDRQIRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVN 64
            |..:.|:..|...:||  :..||.||:.:.|.|:.|.|:|:.:|::||.|||.||.|||||.||.
  Rat    33 VSSVPTNGMAKNGSEADIDESLYSRQLYVLGHEAMKMLQTSSVLVSGLRGLGVEIAKNIILGGVK 97

  Fly    65 SVKLLDDKDVTEEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQF 129
            :|.|.|.......|..|||.:..|.:..||||.|..|...||..|.::|...||.|   :|...|
  Rat    98 AVTLHDQGTTQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVE---DFLSGF 159

  Fly   130 DVVVVNGATNEELLRIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVED-------------V 181
            .|||:..:..||.||:...|...|:|.:..|..|.||..|....:...:.|             |
  Rat   160 QVVVLTNSPLEEQLRVGEFCHSRGIKLVVADTRGLFGQLFCDFGEEMVLTDSNGEQPLSAMVSMV 224

  Fly   182 IKHK---VVANSEKKKKYETVSIPTQRDV-------------------------DYPGYSAW--- 215
            .|..   |....|.:..:||....:..:|                         |...:|.:   
  Rat   225 TKDNPGVVTCLDEARHGFETGDFVSFSEVQGMVQLNGCQPIEIKVLGPYTFSICDTSNFSDYIRG 289

  Fly   216 ----------------LDFDVTEPSYLRK--LKRNGPGVLLL--SVLQKFRTTHKRDPSYKTREA 260
                            |...:.||.::..  .|.:.|..|.:  ..|.:|...|.|.|..:..|.
  Rat   290 GIVSQVKVPKKISFKSLPASLAEPDFVMTDFAKYSRPAQLHIGFQALHQFCAQHNRPPRPRNEED 354

  Fly   261 DLELLR-----------GIRDELLPNSILGDEALGLIFA-QISPAVAVVGGVVAQEVIKVVTKLE 313
            ..||:.           .::.:.:...::  ..|..:.| .::|..|.:||:.||||:|..:...
  Rat   355 ATELVTLAQAVNARSPPAVQQDNVDEDLI--RKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKF 417

  Fly   314 APHRNLFVFDPETC 327
            .|......||...|
  Rat   418 MPIMQWLYFDALEC 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 62/152 (41%)
ThiF 22..>167 CDD:279270 59/144 (41%)
Uba1NP_001014102.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 3/12 (25%)
Ube1 49..1055 CDD:273603 101/388 (26%)
2 approximate repeats. /evidence=ECO:0000255 63..611 97/374 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.