DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and Mocs3

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001101274.1 Gene:Mocs3 / 311655 RGDID:1307044 Length:458 Species:Rattus norvegicus


Alignment Length:403 Identity:79/403 - (19%)
Similarity:124/403 - (30%) Gaps:145/403 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YDRQIRL--WGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEEDFCSQFL 84
            |.||:.|  .|:..|.||..|.:|:.|..|||..:.:.:..:||..:.|:|...|...:...|.|
  Rat    61 YSRQLLLPELGVRGQLRLAAASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDHDVVETSNLARQVL 125

  Fly    85 VPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTS-EFFGQFDVV-----------VVNGA 137
            .........:|.::....|.||..|:.......|.|..: :....:|||           :||.|
  Rat   126 HGEAQAGHAKAWSAAAALRRLNSAVEYVPYARALSEAWALDLVRGYDVVADCSDNVPTRYLVNDA 190

  Fly   138 --------TNEELLRID---------------------------TICRDLGVKFIATDVWGT--- 164
                    .:...||.:                           |.|.|.||..:...|.|.   
  Rat   191 CVLAGRPLVSASALRFEGQMTVYHYDDGPCYRCVFPRPPPAETVTNCADGGVLGVVPGVLGCVQA 255

  Fly   165 -----------------------FGFYFASLQKHSYVEDVI------------KHKVVANSEKKK 194
                                   .|.:|..::......|.:            .::....|....
  Rat   256 LEVLKIAAGLGTTYSGSMLLFDGLGGHFRRIRLRRRRPDCVVCGQQPTVTCLKNYEAFCGSSATD 320

  Fly   195 KYETVSI--PTQRDVDYPGYSAWLDFDVTEPSYLRKLKRNGPGVLL------------------- 238
            |..::.:  |.:|            ..||:  |.|.|....|.|||                   
  Rat   321 KCRSLKLLSPEER------------ISVTD--YKRLLDSGVPHVLLDVRPQVEVDICRLQHSLHI 371

  Fly   239 -LSVLQKFRTTHKRDPSYKTREAD-LELLRGIRDELLPNSILGDEALGLIFAQISPAVAVVGGVV 301
             ||:|::             |:|| |:||.....|...||..|        |.::..|....|..
  Rat   372 PLSLLER-------------RDADSLKLLGAALQEEKRNSQEG--------AALAVYVICKLGND 415

  Fly   302 AQEVIKVVTKLEA 314
            :|:.::|:..|.|
  Rat   416 SQKAVRVLQSLTA 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 45/224 (20%)
ThiF 22..>167 CDD:279270 43/219 (20%)
Mocs3NP_001101274.1 PRK07411 53..458 CDD:180967 79/403 (20%)
ThiF_MoeB_HesA_family 60..283 CDD:238386 44/221 (20%)
RHOD_ThiF 325..458 CDD:238784 31/139 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.