DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and Uba2

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001094049.1 Gene:Uba2 / 308508 RGDID:1312023 Length:639 Species:Rattus norvegicus


Alignment Length:176 Identity:45/176 - (25%)
Similarity:80/176 - (45%) Gaps:27/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEEDFCSQFLVPRESLNTNRAEASLTRARAL 105
            ::|:.|..|:|.|:.||::|:|.:.:.|:|...:...:...|||..::.:..::|:.:.......
  Rat    19 RVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQF 83

  Fly   106 NPMVDISADREPL--KEKTSEFFGQFDVVVVNGATNEELL-RIDTICRDLGVKFIATDVWGTFGF 167
            :|..:|.|..:.:  .:...|||.|| ::|:|...|.... .::.:|....|..|.:   ||.| 
  Rat    84 HPQANIEAHHDSIMNPDYNVEFFRQF-ILVMNALDNRAARNHVNRMCLAADVPLIES---GTAG- 143

  Fly   168 YFASLQKHSYVEDV--IKHKVVANSEKKKKYETVSIPTQRDVDYPG 211
                     |:..|  ||..|.      :.||....||||  .:||
  Rat   144 ---------YLGQVTTIKKGVT------ECYECHPKPTQR--TFPG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 32/133 (24%)
ThiF 22..>167 CDD:279270 31/128 (24%)
Uba2NP_001094049.1 ThiF 9..>175 CDD:279270 45/176 (26%)
Uba2_SUMO 19..443 CDD:238766 45/176 (26%)
UAE_UbL 451..537 CDD:291402
UBA2_C 548..634 CDD:292812
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.