DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and Uba6

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001100683.1 Gene:Uba6 / 305268 RGDID:1308324 Length:1053 Species:Rattus norvegicus


Alignment Length:408 Identity:94/408 - (23%)
Similarity:154/408 - (37%) Gaps:98/408 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ELTEAENELYDRQIRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEE 77
            |..|.::.||.||..:.|..:.:::..:.:.::|:.|||.||.||::|:|:.::.:.|.|.....
  Rat    35 ESLEIDDGLYSRQRYVLGDTAMQKMAKSCVFLSGMGGLGVEIAKNLVLAGIKALTIHDTKKCQAW 99

  Fly    78 DFCSQFLVPRESL--NTNRAEASLTRARALNPMVDISADREPLKEKTS-EFFGQFDVVVVNGATN 139
            |..:.|.:..:.:  ..|||||.|.|...|||.|.:|:...|..|.|. .|..::..||:.....
  Rat   100 DLGTNFFLCEDDVVNERNRAEAVLHRVAELNPYVQVSSSSAPFDETTDLSFLEKYQCVVLTETKL 164

  Fly   140 EELLRIDTICRD--LGVKFIATDVWGTFGFYFASLQKHSYVEDV---------IKHKVVAN---- 189
            ....:|:..|..  ..:|||:|||.|.:...|........|.|.         |.:...||    
  Rat   165 TLQKKINNFCHSHCPPIKFISTDVHGIWSRLFCDFGDEFEVSDTTGEEPKEIFISNITQANPGIV 229

  Fly   190 ---SEKKKKYETVSIPTQRDVDYPGYSAW------------LDFDVTEPSYLRKLKRNGPGV--- 236
               .....|.||....|.|:::  |.:..            ..|.:.:.:.|......|..|   
  Rat   230 TCLENHPHKLETGQFLTFREIN--GMAGLNGSVQQITVISPFSFSIGDTTELDPYLHGGIAVQVK 292

  Fly   237 ----------------------------------LLLSVLQKFRTTHKRDPSYKTREADLELLRG 267
                                              :.:..|.:|:..:.|.|:.:.::..      
  Rat   293 TPKIFNFEPLESQIKHPKCLIADFSKPEAPLQIHVAMLALDQFQENYSRKPNIRCQQDS------ 351

  Fly   268 IRDELLPNSILGDEAL--------GLIF-----AQ--ISPAVAVVGGVVAQEVIKVVTKLEAPHR 317
              ||||..:|...|.|        .::.     ||  :.|..|.||||.:|||:|.||...:|..
  Rat   352 --DELLKLTICISETLEEKPEVNADIVHWLSWTAQGFLPPLAAAVGGVASQEVLKAVTGKFSPLC 414

  Fly   318 NLFVFDPETCAGYVEAIG 335
            .....:   .|..||::|
  Rat   415 QWLYLE---AADTVESLG 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 47/157 (30%)
ThiF 22..>167 CDD:279270 45/149 (30%)
Uba6NP_001100683.1 Ube1 38..1046 CDD:273603 93/405 (23%)
Ube1_repeat1 43..428 CDD:238768 91/397 (23%)
E1_4HB 298..358 CDD:292809 8/67 (12%)
Ube1_repeat2 462..1005 CDD:238767
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.