DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and Uba5

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001009669.1 Gene:Uba5 / 300968 RGDID:1311702 Length:403 Species:Rattus norvegicus


Alignment Length:313 Identity:64/313 - (20%)
Similarity:114/313 - (36%) Gaps:78/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEEDFCSQFLVPRESLN 91
            |:..:...:::||..:.|.|:.|:|:...:.:...|:..:.|.|...|...:....|..|.:: .
  Rat    59 RMGVVSDYEKIRTYAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPYQA-G 122

  Fly    92 TNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQFDVVVVNGATN---------------EE 141
            .::.:|:....|::||  |:..:.......|.|.|..|...:.||...               |.
  Rat   123 MSKVQAAEHTLRSINP--DVLFEVHNYNITTVEHFEHFMNRISNGGLEEGQPVDLVLSCVDNFEA 185

  Fly   142 LLRIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDVIKHK----------VVANS--EKKK 194
            .:.|:|.|.:||      ..|...|....::..|  ::.::..:          |||::  ||..
  Rat   186 RMAINTACNELG------QTWMESGVSENAVSGH--IQLMVPGESACFACAPPLVVASNIDEKTL 242

  Fly   195 KYETV---SIPTQRDV--------------------DYPGYSAWLDFDVT---------EPSYLR 227
            |.|.|   |:||...|                    .|.||:|..||..|         :....|
  Rat   243 KREGVCAASLPTTMGVVAGILVQNVLKFLLKFGTVSFYLGYNAMQDFFPTMFMKPNPQCDDKNCR 307

  Fly   228 K----LKRNGPGVLLLSVLQKFRTTHKRDPSYKTREADLELLRGIRDELLPNS 276
            |    .|:..|.    ...|:.....:.:..::..|..:||:..:.:|.|.||
  Rat   308 KQQEEYKKRAPA----QPTQETAPQEEEEVVHEDNEWGIELVSEVSEEELKNS 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 32/159 (20%)
ThiF 22..>167 CDD:279270 31/154 (20%)
Uba5NP_001009669.1 ThiF_MoeB_HesA_family 50..293 CDD:238386 51/244 (21%)
ThiF 51..307 CDD:279270 52/258 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..337 5/34 (15%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 333..345 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.