DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and MOCS3

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_055299.1 Gene:MOCS3 / 27304 HGNCID:15765 Length:460 Species:Homo sapiens


Alignment Length:418 Identity:89/418 - (21%)
Similarity:143/418 - (34%) Gaps:135/418 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YDRQIRL--WGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEEDFCSQFL 84
            |.||:.|  .|:..|.||.||.:||.|..|||..:.:.:..:||..:.|: |.||.|....::.:
Human    63 YSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLV-DYDVVEMSNLARQV 126

  Fly    85 VPRESL-NTNRAEASLTRARALNPMVDISADREPLKEKTS-EFFGQFDVV-----------VVNG 136
            :..|:| ...:|.::....|.||..|:.....:.|...|: :...::|||           :||.
Human   127 LHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVND 191

  Fly   137 A--------TNEELLRID---------------------------TICRDLGVKFIATDVWGTF- 165
            |        .:...||.:                           |.|.|.||..:.|.|.|.. 
Human   192 ACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQ 256

  Fly   166 ---------GF----------------YFASLQKHS------------YVEDVIKHKVVANSEKK 193
                     |.                :|.|::..|            .|.|::.::....|...
Human   257 ALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSAT 321

  Fly   194 KKYETVSI--PTQRDVDYPGYSAWLDFDVTEPSYLRKLKRNGPGVLLLSVLQKFRTTHKRDP--- 253
            .|..::.:  |.:| |....|...||              :|...|||.|..:......|.|   
Human   322 DKCRSLQLLSPEER-VSVTDYKRLLD--------------SGAFHLLLDVRPQVEVDICRLPHAL 371

  Fly   254 -----SYKTREAD-LELLRGIRDELLPNSILGDEALGLIFAQISPAVAVVG----GVVAQEVIKV 308
                 ..:.|:|: |:||:         ..:.:|..|   .|...||.:..    |..:|:.:|:
Human   372 HIPLKHLERRDAESLKLLK---------EAIWEEKQG---TQEGAAVPIYVICKLGNDSQKAVKI 424

  Fly   309 VTKLEAPHRNLFVFDPETCAGYVEAIGA 336
            :..|.|...    .||.|....|..:.|
Human   425 LQSLSAAQE----LDPLTVRDVVGGLMA 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 50/225 (22%)
ThiF 22..>167 CDD:279270 48/204 (24%)
MOCS3NP_055299.1 ThiF_MoeB_HesA_family 62..285 CDD:238386 49/222 (22%)
RHOD_ThiF 327..460 CDD:238784 33/153 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.