DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and Uba1

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_033483.2 Gene:Uba1 / 22201 MGIID:98890 Length:1118 Species:Mus musculus


Alignment Length:414 Identity:108/414 - (26%)
Similarity:154/414 - (37%) Gaps:103/414 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VVDMDTSETAVELTEA--ENELYDRQIRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVN 64
            |..:.|:..|...:||  :..||.||:.:.|.|:.|.|:|:.:|::||.|||.||.|||||.||.
Mouse    93 VSSVPTNGMAKNGSEADIDESLYSRQLYVLGHEAMKMLQTSSVLVSGLRGLGVEIAKNIILGGVK 157

  Fly    65 SVKLLDDKDVTEEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQF 129
            :|.|.|.......|..|||.:..|.:..||||.|..|...||..|.::|...||.|   :|...|
Mouse   158 AVTLHDQGTTQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVE---DFLSSF 219

  Fly   130 DVVVVNGATNEELLRIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDVIKHKVVANSEKKK 194
            .|||:..:..|..||:...|...|:|.:..|..|.||..|....:...:.|       :|.|:..
Mouse   220 QVVVLTNSPLEAQLRVGEFCHSRGIKLVVADTRGLFGQLFCDFGEEMVLTD-------SNGEQPL 277

  Fly   195 KYETVSIPTQRDVDYPGYSAWLD--------------------------------------FDVT 221
            . ..||:.|:   |.||....||                                      |.:.
Mouse   278 S-AMVSMVTK---DNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSIC 338

  Fly   222 EPSYLRKLKRNG----------------PGVLL---------------------LSVLQKFRTTH 249
            :.|......|.|                |..|:                     ...|.:|...|
Mouse   339 DTSNFSDYIRGGIVSQVKVPKKISFKSLPASLVEPDFVMTDFAKYSRPAQLHIGFQALHQFCALH 403

  Fly   250 KRDPSYKTREADLELLRGIRD--------ELLPNSILGDEALGLIF---AQISPAVAVVGGVVAQ 303
            .:.|..:..|...||: |:..        .:..||:..|....|.:   ..::|..|.:||:.||
Mouse   404 NQPPRPRNEEDATELV-GLAQAVNARSPPSVKQNSLDEDLIRKLAYVAAGDLAPINAFIGGLAAQ 467

  Fly   304 EVIKVVTKLEAPHRNLFVFDPETC 327
            ||:|..:....|......||...|
Mouse   468 EVMKACSGKFMPIMQWLYFDALEC 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 61/152 (40%)
ThiF 22..>167 CDD:279270 58/144 (40%)
Uba1NP_033483.2 ThiF 109..1115 CDD:330201 103/398 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.