DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and moc-3

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_501359.1 Gene:moc-3 / 177607 WormBaseID:WBGene00018357 Length:402 Species:Caenorhabditis elegans


Alignment Length:326 Identity:53/326 - (16%)
Similarity:108/326 - (33%) Gaps:98/326 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MDTSETAVELTEAENELYDRQIRL--WGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVK 67
            |:..:....:::.:...|.||:.:  :|:..||.|:...:||.|..|||..:...:..:|:.::.
 Worm     1 MNDDQWVAGISKKDAGRYSRQLLVDDFGVSGQKNLKNLNVLIVGAGGLGCPVATYLGAAGIGTIG 65

  Fly    68 LLDDKDVTEEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTS-EFFGQFDV 131
            ::|...::.::...|.....:.:..::|:|.....:..|..:::......|....: :.|..:::
 Worm    66 IVDYDHISLDNLHRQVAYKEDQVGKSKAQALADNIKLQNSDLNVQVHNTSLDSSNAMQLFKNYEI 130

  Fly   132 V---VVNGATNEELLRIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDVIKHKVVANSEKK 193
            |   ..|.||.   ..|:.:|..|.:..::    |:...:...|..:.|..|.            
 Worm   131 VCDCTDNVATR---YLINDVCVLLNIPLVS----GSALRWDGQLSVYHYGSDC------------ 176

  Fly   194 KKYETVSIPTQRDVDYPGYSAWLDFDVTEPSYLRKLKRNGPGVLLLSVLQKFRTTHKRDPSYKTR 258
                                         |.|                    |......|.    
 Worm   177 -----------------------------PCY--------------------RCLFPSPPD---- 188

  Fly   259 EADLELLRGIRDELLPNSILGDEALGLIFAQISPAVAVVGGVVAQEVIKVVTKLEAP-HRNLFVF 322
                           |||:......|:    :.|.|.|:|.:.|.||:|:..|:... ...|.:|
 Worm   189 ---------------PNSVTNCNEGGV----LGPIVGVIGSMQALEVMKIAAKVRTTLAGQLLLF 234

  Fly   323 D 323
            |
 Worm   235 D 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 29/158 (18%)
ThiF 22..>167 CDD:279270 29/150 (19%)
moc-3NP_501359.1 PRK07878 8..402 CDD:181156 52/319 (16%)
ThiF_MoeB_HesA_family 17..246 CDD:238386 52/310 (17%)
RHOD_ThiF 283..402 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.