DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and Uba3

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_476553.1 Gene:Uba3 / 117553 RGDID:621084 Length:462 Species:Rattus norvegicus


Alignment Length:336 Identity:66/336 - (19%)
Similarity:115/336 - (34%) Gaps:105/336 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEEDFCSQFLVPRESLNTNRAEASLTR 101
            |.|.|:|:.|..|||.|:.||:.|||...:.::|...:...:...|||...:.:...:||.:   
  Rat    67 LDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVA--- 128

  Fly   102 ARALN---PMVDISADREPLKEKTSEFFGQFDVVV-----------VNGATNEELLRIDTICRDL 152
            |..||   |..::......:::....|:.||.::|           :||      :.|..:..:.
  Rat   129 AEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWING------MLISLLNYED 187

  Fly   153 GV----KFIATDVWGTFGF-------------------------------YFASLQKHSYVEDVI 182
            ||    ..:.....||.||                               ..||:.:  ..|..|
  Rat   188 GVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPR--LPEHCI 250

  Fly   183 KHKVVANSEKKKKYETVSIPTQRDVDYPGYSAWLDFDVTEPSYLRKLKRNGPGVLLLSVLQKFRT 247
            ::..:....|::.:.. .:|.  |.|.|.:..|:                            |:.
  Rat   251 EYVRMLQWPKEQPFGD-GVPL--DGDDPEHIQWI----------------------------FQK 284

  Fly   248 THKRDPSYKTREADLELLRGIRDELLPNSILGDEALGLIFAQISPAVAVVGGVVAQEVIKVVTKL 312
            :.:|...|..|.....|.:|:...::|              .::...||:..|.|.||.|:.|..
  Rat   285 SVERASQYNIRGVTYRLTQGVVKRIIP--------------AVASTNAVIAAVCATEVFKIATSA 335

  Fly   313 EAPHRNLFVFD 323
            ..|..|..||:
  Rat   336 YIPLNNYLVFN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 38/183 (21%)
ThiF 22..>167 CDD:279270 35/147 (24%)
Uba3NP_476553.1 Interaction with UBE2M N-terminus. /evidence=ECO:0000250 53..70 1/2 (50%)
Uba3_RUB 71..368 CDD:238765 64/332 (19%)
Interaction with UBE2M N-terminus. /evidence=ECO:0000250 157..161 2/3 (67%)
Interaction with UBE2M N-terminus. /evidence=ECO:0000250 192..217 4/24 (17%)
Interaction with NEDD8. /evidence=ECO:0000250 227..229 0/1 (0%)
Interaction with NAE1. /evidence=ECO:0000250 242..248 0/7 (0%)
Interaction with NAE1. /evidence=ECO:0000250 292..295 1/2 (50%)
Interaction with UBE2M N-terminus. /evidence=ECO:0000250 331..338 1/6 (17%)
Interaction with NEDD8. /evidence=ECO:0000250 352..357
Interaction with UBE2M core domain. /evidence=ECO:0000250 368..462
E2_bind 376..461 CDD:400951
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.