DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aos1 and UBA2

DIOPT Version :9

Sequence 1:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_005258461.2 Gene:UBA2 / 10054 HGNCID:30661 Length:752 Species:Homo sapiens


Alignment Length:205 Identity:47/205 - (22%)
Similarity:78/205 - (38%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 WG----LESQKRLRTAKILIAGLCGLGAEITKNIILS------------GVNSVKL-LDDKDVTE 76
            ||    ..|..|:..:.:.....|..|..|...::|.            .|..::: ||..||: 
Human   104 WGRAASAASSSRISCSPVSPTSTCHQGLTILLRLVLKVWAQAILSLCPPKVLGLQIDLDTIDVS- 167

  Fly    77 EDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPL--KEKTSEFFGQFDVVVVNGATN 139
             :...|||..::.:..::|:.:........|..:|.|..:.:  .:...|||.|| ::|:|...|
Human   168 -NLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQF-ILVMNALDN 230

  Fly   140 EELL-RIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDV--IKHKVVANSEKKKKYETVSI 201
            .... .::.:|....|..|.:   ||.|          |:..|  ||..|.      :.||....
Human   231 RAARNHVNRMCLAADVPLIES---GTAG----------YLGQVTTIKKGVT------ECYECHPK 276

  Fly   202 PTQRDVDYPG 211
            ||||  .:||
Human   277 PTQR--TFPG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 34/162 (21%)
ThiF 22..>167 CDD:279270 33/157 (21%)
UBA2XP_005258461.2 Uba2_SUMO 159..556 CDD:238766 38/150 (25%)
UBA_e1_thiolCys 291..474 CDD:287545
UAE_UbL 564..650 CDD:291402
UBA2_C 661..747 CDD:292812
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.