Sequence 1: | NP_650198.1 | Gene: | Aos1 / 41532 | FlyBaseID: | FBgn0029512 | Length: | 337 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005258461.2 | Gene: | UBA2 / 10054 | HGNCID: | 30661 | Length: | 752 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 47/205 - (22%) |
---|---|---|---|
Similarity: | 78/205 - (38%) | Gaps: | 46/205 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 WG----LESQKRLRTAKILIAGLCGLGAEITKNIILS------------GVNSVKL-LDDKDVTE 76
Fly 77 EDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPL--KEKTSEFFGQFDVVVVNGATN 139
Fly 140 EELL-RIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVEDV--IKHKVVANSEKKKKYETVSI 201
Fly 202 PTQRDVDYPG 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Aos1 | NP_650198.1 | Aos1_SUMO | 19..>172 | CDD:238769 | 34/162 (21%) |
ThiF | 22..>167 | CDD:279270 | 33/157 (21%) | ||
UBA2 | XP_005258461.2 | Uba2_SUMO | 159..556 | CDD:238766 | 38/150 (25%) |
UBA_e1_thiolCys | 291..474 | CDD:287545 | |||
UAE_UbL | 564..650 | CDD:291402 | |||
UBA2_C | 661..747 | CDD:292812 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0476 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |