DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and PAF2

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_175158.1 Gene:PAF2 / 841128 AraportID:AT1G47250 Length:277 Species:Arabidopsis thaliana


Alignment Length:246 Identity:79/246 - (32%)
Similarity:135/246 - (54%) Gaps:19/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPL-YEQHSVHR 64
            |...:|...:||:||:|:|.|:|||:.||..|:.::|:.:.:.||:|..||.:|.| ..|..:.:
plant     1 MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQRKIFK 65

  Fly    65 VEMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRP 129
            |:   :|||:..:|:..|.|:|.:..|..:..:..||:.|:||.:||..:|...|..||....||
plant    66 VD---DHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRP 127

  Fly   130 FGVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYS--EDLELDDAVHTAI 192
            :||.||:.|.|....:||.:.|||.||.::|.|:|..:...||:||:::.  ::...:|.:..||
plant   128 YGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFESFQESSKEDLIKDAI 192

  Fly   193 LTLKEGFEGKMTADNIEIGICD------QNGFQRLDPASIK---DYLASIP 234
            :.::|..:|    :.::..:|.      ...|..||..||:   |....:|
plant   193 MAIRETLQG----ETLKSSLCTVSVLGVDEPFHFLDQESIQKVIDTFEKVP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 77/236 (33%)
PAF2NP_175158.1 proteasome_alpha_type_1 6..215 CDD:239718 71/215 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.