DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and PAB1

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001031057.1 Gene:PAB1 / 838217 AraportID:AT1G16470 Length:235 Species:Arabidopsis thaliana


Alignment Length:234 Identity:151/234 - (64%)
Similarity:188/234 - (80%) Gaps:1/234 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRV 65
            |...:||||||||||||||||:|:||.||..|..|:||.||||||||||.|..|.|.::.||.::
plant     1 MGDSQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEASVQKI 65

  Fly    66 EMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPF 130
            :.:..:||:||||||||:|:||:::||.|:.|...|||||||:|||:..||:|||:|||||||||
plant    66 QHLTPNIGVVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGGVRPF 130

  Fly   131 GVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTL 195
            |||||:.|:|:..|.|||.||||:||:|||:|||||..|.||||||||:||:|||||:|||||||
plant   131 GVSLLVAGYDDKGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTEDMELDDAIHTAILTL 195

  Fly   196 KEGFEGKMTADNIEIG-ICDQNGFQRLDPASIKDYLASI 233
            ||||||::::.||||| |.....|:.|.||.|.||||.:
plant   196 KEGFEGEISSKNIEIGKIGADKVFRVLTPAEIDDYLAEV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 148/225 (66%)
PAB1NP_001031057.1 proteasome_alpha_type_2 6..232 CDD:239719 148/225 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 247 1.000 Domainoid score I541
eggNOG 1 0.900 - - E1_KOG0181
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2081
Inparanoid 1 1.050 300 1.000 Inparanoid score I785
OMA 1 1.010 - - QHG54016
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0003690
OrthoInspector 1 1.000 - - otm3555
orthoMCL 1 0.900 - - OOG6_101969
Panther 1 1.100 - - LDO PTHR11599
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2555
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.930

Return to query results.
Submit another query.