DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and PAD2

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_201415.1 Gene:PAD2 / 836746 AraportID:AT5G66140 Length:250 Species:Arabidopsis thaliana


Alignment Length:235 Identity:95/235 - (40%)
Similarity:141/235 - (60%) Gaps:11/235 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIY 69
            ||..::|.|||.|.|.|:||||.||..|..:||:..::.||:|.|.|....|.:..|..::..:.
plant     3 RYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSARKIVSLD 67

  Fly    70 NHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSL 134
            |||.:..:|:..|.|:|:.:||...|::.||.::|:.|..:.:.:|.|.|:|||||||||||:|.
plant    68 NHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLST 132

  Fly   135 LICGWD--NDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKE 197
            ||.|:|  :..|.|||:||||.:.||||.|.|:|:.:.:.||||.|.|. ...:.:..||..|.|
plant   133 LIVGFDPYSRLPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKES-SGQETIKLAIRALLE 196

  Fly   198 GFE--GKMTADNIEIGIC--DQNGFQRLDPASIKDYLASI 233
            ..|  ||    |||:.:.  ::.|.::|:.|.|...:|.|
plant   197 VVESGGK----NIEVAVMTREETGLRQLEEAEIDAIVAKI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 92/230 (40%)
PAD2NP_201415.1 PRK03996 1..229 CDD:235192 93/230 (40%)
proteasome_alpha_type_7 4..210 CDD:239724 88/210 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.