DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and PSMA4

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001096137.1 Gene:PSMA4 / 5685 HGNCID:9533 Length:261 Species:Homo sapiens


Alignment Length:222 Identity:88/222 - (39%)
Similarity:128/222 - (57%) Gaps:9/222 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEM 67
            :.||....|.|||.|:|.|:|||:.|:......:||:|::||::|.|.::...|.::  |...|.
Human     2 SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDE--VFFSEK 64

  Fly    68 IY---NHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRP 129
            ||   ..:....:|:..|..:|..:.|.|||.|.|.|:||||..|||..:..:.|.|||.||.||
Human    65 IYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRP 129

  Fly   130 FGVSLLICGWDNDRPY-LYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSE-DLELDDAVHTAI 192
            ||||||..|||....: ||||||||.|..||||.:|.|:....:.|::.|.| ::.|..|:..||
Human   130 FGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAI 194

  Fly   193 LTLKEGFE-GKMTADNIEIG-ICDQNG 217
            ..|.:..: .|::|:.:||. :..:||
Human   195 KVLNKTMDVSKLSAEKVEIATLTRENG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 87/219 (40%)
PSMA4NP_001096137.1 proteasome_alpha_type_4 3..216 CDD:239721 86/214 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.