DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and PSMA2

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_002778.1 Gene:PSMA2 / 5683 HGNCID:9531 Length:234 Species:Homo sapiens


Alignment Length:233 Identity:182/233 - (78%)
Similarity:209/233 - (89%) Gaps:0/233 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRV 65
            ||...||||||||||||||||:|||||||:||||||||.|:||||:|||.|.||.||::.|||:|
Human     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKV 65

  Fly    66 EMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPF 130
            |.|..|||:||||||||||:||.:|||:||.|||.|:||||.:|||||||::|||||||||||||
Human    66 EPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPF 130

  Fly   131 GVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTL 195
            |||||||||:..||||:|||||||||||||||||||.|||||||||||:|||||:||:|||||||
Human   131 GVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTL 195

  Fly   196 KEGFEGKMTADNIEIGICDQNGFQRLDPASIKDYLASI 233
            ||.|||:||.||||:|||::.||:||.|..:|||||:|
Human   196 KESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 177/224 (79%)
PSMA2NP_002778.1 proteasome_alpha_type_2 6..231 CDD:239719 177/224 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145097
Domainoid 1 1.000 304 1.000 Domainoid score I1388
eggNOG 1 0.900 - - E1_KOG0181
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2081
Inparanoid 1 1.050 379 1.000 Inparanoid score I2079
Isobase 1 0.950 - 0 Normalized mean entropy S257
OMA 1 1.010 - - QHG54016
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0003690
OrthoInspector 1 1.000 - - oto88627
orthoMCL 1 0.900 - - OOG6_101969
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1004
SonicParanoid 1 1.000 - - X2555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.