DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Prosbeta1

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:208 Identity:52/208 - (25%)
Similarity:82/208 - (39%) Gaps:34/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VSGGAPSVGIIASNGVVIATENKHKSPLYEQHSV-HRVEMIYNHIGMVYSGMGPDYRLLVKQARK 92
            ||.|...:.:....||||..:::..|..|..:.| .::..|.:.:....||...|     .||..
  Fly    12 VSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAAD-----TQAIA 71

  Fly    93 IAQTYYLTYKE-PIPVSQLVQRVATLMQEYTQSGGVRPFGVSLL----ICGWDNDRPYLYQSDPS 152
            ....|.|.|.| ......||...|:..:.|..|     :..|||    :.|||..|.....|.|.
  Fly    72 DIVAYSLNYHENQTNKDALVFEAASEFRNYCYS-----YRESLLAGIIVAGWDEQRGGQVYSIPL 131

  Fly   153 GAYFAWKATAM---GKNAVNGKTFLEKRYSEDLELDD-------AVHTAILTLKEGFEGKMTADN 207
            |.....::..:   |.:.:.|  |:.:.|..::.|:|       ||..||  ..:|..|.:    
  Fly   132 GGMLTRESCTIGGSGSSFIYG--FVREHYRPNMALEDCVTFVKKAVQHAI--YHDGSSGGV---- 188

  Fly   208 IEIGICDQNGFQR 220
            :.|||..::|.:|
  Fly   189 VRIGIITKDGIER 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 52/208 (25%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 49/203 (24%)
proteasome_beta_type_6 16..203 CDD:239731 49/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.