DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Prosalpha3T

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster


Alignment Length:223 Identity:84/223 - (37%)
Similarity:113/223 - (50%) Gaps:13/223 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RYSFSLTT-FSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMI 68
            |:..|.|| |||.|:|.|:|||:.|.|.....||::|.|||::|||......:.....|.|:..:
  Fly     3 RFFDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLMDTSIPVPRISWL 67

  Fly    69 YNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVS 133
            ..:|....:|...|..:||.|.|.|||.|...:.|.||..|||..:..:.|.|||.||.||||||
  Fly    68 NENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVS 132

  Fly   134 LLICGWDNDRPY-LYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRY--------SEDLELDDAVH 189
            .|..|||....: ||||||||.|..||||.:|:.:......|:|..        |.:...|.|:.
  Fly   133 FLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPSVEEAKDVAIK 197

  Fly   190 TAILTLKEGFEGKMTADNIEIGICDQNG 217
            ...:||.   ...:|.:.:||....:.|
  Fly   198 VMGMTLG---RDSLTPEKLEIAFVQRYG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 83/222 (37%)
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 84/223 (38%)
Ntn_hydrolase 3..218 CDD:294319 83/217 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.