DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Psma3l

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001004094.1 Gene:Psma3l / 408248 RGDID:1598236 Length:255 Species:Rattus norvegicus


Alignment Length:220 Identity:72/220 - (32%)
Similarity:107/220 - (48%) Gaps:15/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYN 70
            |..|.:||||.|::.|:|||:.||...:.::||...:|||...|....|.|||:.|..|:..:..
  Rat     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDR 72

  Fly    71 HIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLL 135
            |:||..:|:..|.|.|...||:.|..:...:...||:..|..|||..:..||....|||||.|.:
  Rat    73 HVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFM 137

  Fly   136 ICGWD-NDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDA----------VH 189
            :..:. ||...||..||||..:.:...|:||.....||.:||...:::...|.          ||
  Rat   138 LGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVH 202

  Fly   190 TAI----LTLKEGFEGKMTADNIEI 210
            ..:    ..|:..:.|::|....||
  Rat   203 DEVKDKAFELELSWVGELTKGRHEI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 72/220 (33%)
Psma3lNP_001004094.1 proteasome_alpha_type_3 5..217 CDD:239720 68/208 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.